Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7SB66

Protein Details
Accession J7SB66    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
247-268GDSTNIKRRKIEKSEKDEDKEABasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, cyto 9, nucl 8, E.R. 4, vacu 2, mito 1, extr 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR006818  ASF1-like  
IPR036747  ASF1-like_sf  
IPR017282  Hist_deposition_Asf1  
Gene Ontology GO:0005634  C:nucleus  
GO:0042393  F:histone binding  
GO:0016573  P:histone acetylation  
GO:0006334  P:nucleosome assembly  
GO:0006337  P:nucleosome disassembly  
KEGG ndi:NDAI_0G06050  -  
Pfam View protein in Pfam  
PF04729  ASF1_hist_chap  
Amino Acid Sequences MSIVSLLDIEILNNPAKFTDPYEFQITFECLEPLKNDLEWKLTYVGSSRSLEHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDSEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNEKESDIYPPEQPNVDEEEDEEEDEDEEEEGEEEEEEEEDGEGQDDDAEGEEEEAEEDEEAEEDEEAEEDLGESENEGADKLVEEEISDKEDGDSTNIKRRKIEKSEKDEDKEAIVSTPRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.16
4 0.16
5 0.18
6 0.22
7 0.23
8 0.28
9 0.34
10 0.33
11 0.31
12 0.34
13 0.31
14 0.26
15 0.23
16 0.2
17 0.15
18 0.16
19 0.17
20 0.16
21 0.16
22 0.16
23 0.17
24 0.18
25 0.22
26 0.2
27 0.22
28 0.21
29 0.19
30 0.19
31 0.19
32 0.2
33 0.2
34 0.21
35 0.2
36 0.23
37 0.26
38 0.26
39 0.25
40 0.24
41 0.2
42 0.2
43 0.2
44 0.15
45 0.12
46 0.11
47 0.09
48 0.08
49 0.07
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.1
59 0.09
60 0.09
61 0.09
62 0.13
63 0.13
64 0.13
65 0.14
66 0.15
67 0.15
68 0.14
69 0.13
70 0.09
71 0.09
72 0.09
73 0.08
74 0.07
75 0.06
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.07
90 0.08
91 0.11
92 0.11
93 0.11
94 0.12
95 0.11
96 0.12
97 0.14
98 0.14
99 0.13
100 0.14
101 0.14
102 0.13
103 0.13
104 0.13
105 0.12
106 0.12
107 0.11
108 0.11
109 0.11
110 0.16
111 0.16
112 0.16
113 0.16
114 0.17
115 0.17
116 0.17
117 0.17
118 0.2
119 0.22
120 0.23
121 0.22
122 0.21
123 0.2
124 0.19
125 0.19
126 0.13
127 0.12
128 0.12
129 0.13
130 0.16
131 0.2
132 0.22
133 0.23
134 0.25
135 0.24
136 0.31
137 0.34
138 0.32
139 0.34
140 0.34
141 0.36
142 0.32
143 0.32
144 0.23
145 0.19
146 0.2
147 0.17
148 0.17
149 0.15
150 0.16
151 0.17
152 0.17
153 0.16
154 0.16
155 0.18
156 0.17
157 0.14
158 0.13
159 0.16
160 0.16
161 0.16
162 0.14
163 0.1
164 0.09
165 0.09
166 0.09
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.05
181 0.05
182 0.05
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.04
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.04
210 0.04
211 0.05
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.05
220 0.05
221 0.06
222 0.07
223 0.07
224 0.07
225 0.07
226 0.09
227 0.1
228 0.13
229 0.12
230 0.11
231 0.11
232 0.13
233 0.13
234 0.15
235 0.21
236 0.22
237 0.32
238 0.36
239 0.37
240 0.43
241 0.49
242 0.56
243 0.6
244 0.68
245 0.68
246 0.74
247 0.82
248 0.84
249 0.83
250 0.77
251 0.68
252 0.59
253 0.5
254 0.42
255 0.34