Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Z8D7

Protein Details
Accession A0A165Z8D7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-71TATGPKGPPKPKPKPKRSVLPSGSHydrophilic
NLS Segment(s)
PositionSequence
52-65PKGPPKPKPKPKRS
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MVHNTYRYARRHDVHPPYTRTYNSESTVREVYPTWSPASSCYGPTNPTATGPKGPPKPKPKPKRSVLPSGSPRHDSLSMLPHSPVSSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.64
4 0.63
5 0.64
6 0.6
7 0.53
8 0.49
9 0.45
10 0.4
11 0.39
12 0.34
13 0.33
14 0.34
15 0.3
16 0.25
17 0.21
18 0.21
19 0.19
20 0.19
21 0.16
22 0.15
23 0.15
24 0.15
25 0.2
26 0.18
27 0.17
28 0.18
29 0.18
30 0.18
31 0.19
32 0.2
33 0.14
34 0.15
35 0.16
36 0.15
37 0.18
38 0.19
39 0.25
40 0.31
41 0.35
42 0.42
43 0.5
44 0.6
45 0.68
46 0.76
47 0.79
48 0.81
49 0.85
50 0.87
51 0.84
52 0.84
53 0.78
54 0.77
55 0.75
56 0.73
57 0.7
58 0.62
59 0.57
60 0.51
61 0.47
62 0.38
63 0.33
64 0.33
65 0.31
66 0.29
67 0.28
68 0.25
69 0.24