Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZYD7

Protein Details
Accession A0A165ZYD7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-84KEELRLKRKEQKRGKEKEMGPBasic
NLS Segment(s)
PositionSequence
67-85LRLKRKEQKRGKEKEMGPK
126-131SKKRKR
Subcellular Location(s) nucl 14.5, mito_nucl 13.166, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MSTIVQTRPTFPLSIVMPKCRRRTATAVMAGDFDPRPQRDALTSLLNGVKPYTPRLTEEQMREKEELRLKRKEQKRGKEKEMGPKVRHANTSQNIQDPSVDARRVVPDDAPSTVDHPQGGDNESRSKKRKRPGDGMSSFWMASSVRTASSMINSPEHTPEPSDHSDYSSRSSSKRPHTPEDDLLRRSASTDPRLEVDEDELPKDKLIELDSVPILQERRTRSGKNFDAIGEGHDTWVSRLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.41
4 0.47
5 0.55
6 0.61
7 0.63
8 0.64
9 0.61
10 0.64
11 0.64
12 0.64
13 0.64
14 0.59
15 0.52
16 0.5
17 0.43
18 0.39
19 0.3
20 0.23
21 0.22
22 0.21
23 0.23
24 0.22
25 0.23
26 0.22
27 0.25
28 0.25
29 0.23
30 0.22
31 0.23
32 0.25
33 0.24
34 0.22
35 0.2
36 0.2
37 0.16
38 0.21
39 0.22
40 0.21
41 0.24
42 0.29
43 0.35
44 0.38
45 0.44
46 0.49
47 0.48
48 0.5
49 0.48
50 0.44
51 0.45
52 0.46
53 0.48
54 0.45
55 0.49
56 0.52
57 0.61
58 0.67
59 0.71
60 0.73
61 0.75
62 0.79
63 0.8
64 0.81
65 0.81
66 0.79
67 0.79
68 0.79
69 0.76
70 0.68
71 0.66
72 0.65
73 0.59
74 0.56
75 0.48
76 0.47
77 0.41
78 0.46
79 0.4
80 0.38
81 0.35
82 0.33
83 0.3
84 0.22
85 0.23
86 0.19
87 0.18
88 0.14
89 0.14
90 0.16
91 0.17
92 0.17
93 0.14
94 0.12
95 0.13
96 0.14
97 0.14
98 0.12
99 0.14
100 0.15
101 0.14
102 0.12
103 0.11
104 0.11
105 0.11
106 0.12
107 0.11
108 0.1
109 0.17
110 0.2
111 0.25
112 0.31
113 0.38
114 0.43
115 0.5
116 0.57
117 0.58
118 0.65
119 0.66
120 0.7
121 0.65
122 0.62
123 0.57
124 0.5
125 0.42
126 0.32
127 0.25
128 0.15
129 0.12
130 0.1
131 0.08
132 0.07
133 0.08
134 0.09
135 0.08
136 0.1
137 0.13
138 0.13
139 0.14
140 0.15
141 0.16
142 0.18
143 0.19
144 0.18
145 0.16
146 0.16
147 0.2
148 0.22
149 0.24
150 0.22
151 0.24
152 0.26
153 0.26
154 0.28
155 0.26
156 0.25
157 0.24
158 0.3
159 0.35
160 0.41
161 0.49
162 0.51
163 0.55
164 0.6
165 0.64
166 0.66
167 0.67
168 0.65
169 0.57
170 0.53
171 0.46
172 0.39
173 0.34
174 0.31
175 0.28
176 0.27
177 0.29
178 0.29
179 0.3
180 0.32
181 0.31
182 0.27
183 0.24
184 0.24
185 0.22
186 0.23
187 0.23
188 0.22
189 0.21
190 0.2
191 0.17
192 0.14
193 0.14
194 0.15
195 0.14
196 0.17
197 0.17
198 0.17
199 0.17
200 0.17
201 0.17
202 0.17
203 0.22
204 0.23
205 0.31
206 0.37
207 0.42
208 0.47
209 0.56
210 0.58
211 0.58
212 0.54
213 0.47
214 0.45
215 0.4
216 0.35
217 0.3
218 0.24
219 0.21
220 0.19
221 0.19