Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165XLX8

Protein Details
Accession A0A165XLX8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-85DLSRVQDEWKKRRWHKKRLFSGLEPSDHydrophilic
NLS Segment(s)
PositionSequence
68-76KKRRWHKKR
Subcellular Location(s) nucl 13, mito 10, cyto_nucl 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MWQSPSKAQGSASRGEASVARNDATWGWVDRDKDLVNVGGKLDQQERGIIGGAALLPVDLSRVQDEWKKRRWHKKRLFSGLEPSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.27
4 0.21
5 0.22
6 0.2
7 0.17
8 0.16
9 0.16
10 0.16
11 0.14
12 0.14
13 0.11
14 0.13
15 0.15
16 0.16
17 0.16
18 0.19
19 0.18
20 0.17
21 0.16
22 0.16
23 0.13
24 0.13
25 0.13
26 0.11
27 0.11
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.1
34 0.09
35 0.09
36 0.08
37 0.06
38 0.05
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.05
48 0.07
49 0.07
50 0.1
51 0.16
52 0.26
53 0.32
54 0.41
55 0.5
56 0.59
57 0.7
58 0.78
59 0.84
60 0.86
61 0.89
62 0.92
63 0.92
64 0.9
65 0.84