Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AHI8

Protein Details
Accession A0A166AHI8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
189-211LGPSTPPPRKSHRRERRHSTGAGBasic
NLS Segment(s)
PositionSequence
195-205PPRKSHRRERR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MSEYGPPTENEIRQWKTQLSRTANWVSNHSSPTASSPSSSRPSTSRTNSNSSHSHHRSPTSPGQLPPLPPGFKYAAPGTPVSFATQSATYYVVPPGQDPAAFVNSPQGSSPHRSHHRSSSHHHSSSSRTSTPQPHNPRITTSGNVKVTYVTGPSPGPMRPPVYHAYSTPSPAYIQPKKEKPLLQRLFGLGPSTPPPRKSHRRERRHSTGAGGNSRDNGLTIAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.47
4 0.52
5 0.55
6 0.54
7 0.53
8 0.56
9 0.59
10 0.6
11 0.55
12 0.52
13 0.48
14 0.45
15 0.43
16 0.37
17 0.31
18 0.25
19 0.27
20 0.28
21 0.22
22 0.19
23 0.2
24 0.25
25 0.3
26 0.3
27 0.28
28 0.27
29 0.31
30 0.39
31 0.42
32 0.45
33 0.45
34 0.5
35 0.51
36 0.54
37 0.54
38 0.5
39 0.55
40 0.51
41 0.52
42 0.49
43 0.49
44 0.47
45 0.48
46 0.52
47 0.49
48 0.48
49 0.42
50 0.45
51 0.44
52 0.43
53 0.4
54 0.38
55 0.31
56 0.27
57 0.3
58 0.26
59 0.24
60 0.26
61 0.23
62 0.2
63 0.21
64 0.21
65 0.18
66 0.18
67 0.17
68 0.16
69 0.14
70 0.12
71 0.12
72 0.11
73 0.11
74 0.1
75 0.11
76 0.09
77 0.1
78 0.1
79 0.1
80 0.09
81 0.09
82 0.1
83 0.09
84 0.09
85 0.09
86 0.1
87 0.11
88 0.11
89 0.1
90 0.14
91 0.14
92 0.14
93 0.14
94 0.14
95 0.13
96 0.18
97 0.21
98 0.24
99 0.3
100 0.34
101 0.37
102 0.43
103 0.48
104 0.48
105 0.52
106 0.54
107 0.55
108 0.52
109 0.51
110 0.45
111 0.42
112 0.45
113 0.43
114 0.34
115 0.28
116 0.31
117 0.38
118 0.43
119 0.48
120 0.5
121 0.53
122 0.57
123 0.56
124 0.55
125 0.52
126 0.48
127 0.41
128 0.37
129 0.37
130 0.34
131 0.34
132 0.31
133 0.25
134 0.24
135 0.21
136 0.18
137 0.1
138 0.1
139 0.1
140 0.1
141 0.12
142 0.11
143 0.14
144 0.16
145 0.2
146 0.19
147 0.23
148 0.26
149 0.29
150 0.3
151 0.28
152 0.31
153 0.29
154 0.31
155 0.27
156 0.24
157 0.21
158 0.23
159 0.32
160 0.31
161 0.38
162 0.44
163 0.5
164 0.54
165 0.6
166 0.62
167 0.61
168 0.66
169 0.64
170 0.58
171 0.54
172 0.52
173 0.48
174 0.42
175 0.36
176 0.25
177 0.22
178 0.23
179 0.28
180 0.29
181 0.31
182 0.35
183 0.43
184 0.54
185 0.61
186 0.68
187 0.71
188 0.78
189 0.85
190 0.9
191 0.9
192 0.87
193 0.8
194 0.74
195 0.71
196 0.68
197 0.65
198 0.58
199 0.49
200 0.43
201 0.42
202 0.36
203 0.28