Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Y6Q7

Protein Details
Accession A0A165Y6Q7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-38RGIHVHRRTSRKKKTISLRQHABasic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MMRLLLLAPTLSIFSLRGIHVHRRTSRKKKTISLRQHADHIENICFSHTSNRFLNTKCDISCPLNQTNSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.1
4 0.12
5 0.16
6 0.25
7 0.3
8 0.37
9 0.43
10 0.5
11 0.61
12 0.68
13 0.75
14 0.75
15 0.76
16 0.77
17 0.8
18 0.81
19 0.81
20 0.8
21 0.75
22 0.68
23 0.66
24 0.59
25 0.49
26 0.42
27 0.33
28 0.25
29 0.19
30 0.18
31 0.14
32 0.13
33 0.12
34 0.18
35 0.18
36 0.22
37 0.24
38 0.28
39 0.31
40 0.32
41 0.38
42 0.35
43 0.37
44 0.33
45 0.35
46 0.36
47 0.37
48 0.41
49 0.41
50 0.42