Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165XVR0

Protein Details
Accession A0A165XVR0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-91PLSSSRYQKRDGRHRYRNRRBasic
NLS Segment(s)
PositionSequence
83-91GRHRYRNRR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRNESQVRNIRRLLETVFMLLIQGEKRKLERVAETCSYVPEITNVDVSDLEPDFKLRRVAREQLAVQGMKAPLSSSRYQKRDGRHRYRNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.24
4 0.22
5 0.17
6 0.15
7 0.12
8 0.11
9 0.09
10 0.12
11 0.12
12 0.14
13 0.15
14 0.19
15 0.22
16 0.23
17 0.28
18 0.29
19 0.34
20 0.34
21 0.35
22 0.31
23 0.3
24 0.28
25 0.21
26 0.17
27 0.11
28 0.11
29 0.09
30 0.1
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.07
37 0.07
38 0.06
39 0.08
40 0.08
41 0.1
42 0.16
43 0.16
44 0.21
45 0.26
46 0.32
47 0.33
48 0.38
49 0.38
50 0.36
51 0.39
52 0.33
53 0.28
54 0.27
55 0.24
56 0.18
57 0.17
58 0.14
59 0.13
60 0.18
61 0.23
62 0.28
63 0.38
64 0.41
65 0.48
66 0.53
67 0.6
68 0.65
69 0.72
70 0.74
71 0.75