Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EDS6

Protein Details
Accession J6EDS6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28SSLVPKRQLHQQQQDQQDQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013900  RNR_inhibitor  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Amino Acid Sequences MDAQLEWASSLVPKRQLHQQQQDQQDQQKQEDLHKDQLMTVGMRIRQRVDQGYASSTPGTSQASLQPGVIRDYSSVIVPQFTRSPLPTANSLPPMLINQRTMSTEASSLEKWGVPESAAEHETMVNGTKRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.38
3 0.48
4 0.55
5 0.63
6 0.68
7 0.68
8 0.75
9 0.8
10 0.75
11 0.72
12 0.69
13 0.61
14 0.53
15 0.49
16 0.43
17 0.41
18 0.44
19 0.42
20 0.41
21 0.4
22 0.39
23 0.34
24 0.35
25 0.3
26 0.22
27 0.18
28 0.15
29 0.17
30 0.19
31 0.19
32 0.19
33 0.19
34 0.22
35 0.23
36 0.23
37 0.22
38 0.21
39 0.23
40 0.22
41 0.21
42 0.18
43 0.15
44 0.12
45 0.11
46 0.11
47 0.08
48 0.08
49 0.1
50 0.11
51 0.12
52 0.12
53 0.11
54 0.11
55 0.13
56 0.12
57 0.1
58 0.08
59 0.09
60 0.1
61 0.09
62 0.09
63 0.08
64 0.09
65 0.09
66 0.1
67 0.1
68 0.11
69 0.13
70 0.13
71 0.15
72 0.16
73 0.18
74 0.19
75 0.21
76 0.23
77 0.24
78 0.23
79 0.2
80 0.19
81 0.19
82 0.2
83 0.19
84 0.17
85 0.16
86 0.18
87 0.19
88 0.2
89 0.2
90 0.17
91 0.16
92 0.16
93 0.18
94 0.17
95 0.16
96 0.16
97 0.15
98 0.15
99 0.15
100 0.14
101 0.11
102 0.12
103 0.13
104 0.17
105 0.16
106 0.16
107 0.15
108 0.14
109 0.14
110 0.14
111 0.16
112 0.16