Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J5S8U1

Protein Details
Accession J5S8U1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-106GRHHVYKKAKLMKQSKKKTSFTRFHydrophilic
NLS Segment(s)
PositionSequence
84-100RHHVYKKAKLMKQSKKK
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSIRASSHINAKAVKRRGVFQKAVDAREQRISNKLKEDLLKQKLEDLKKKEEQGINMDVDEKKPVEEALKKKITTSGWRDGRHHVYKKAKLMKQSKKKTSFTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.55
4 0.47
5 0.49
6 0.55
7 0.59
8 0.57
9 0.5
10 0.54
11 0.53
12 0.53
13 0.52
14 0.45
15 0.39
16 0.42
17 0.41
18 0.33
19 0.36
20 0.38
21 0.36
22 0.38
23 0.37
24 0.34
25 0.35
26 0.39
27 0.4
28 0.42
29 0.4
30 0.36
31 0.39
32 0.41
33 0.44
34 0.45
35 0.4
36 0.42
37 0.44
38 0.46
39 0.46
40 0.43
41 0.39
42 0.36
43 0.34
44 0.27
45 0.23
46 0.24
47 0.18
48 0.17
49 0.17
50 0.12
51 0.09
52 0.09
53 0.1
54 0.12
55 0.19
56 0.23
57 0.3
58 0.36
59 0.36
60 0.36
61 0.41
62 0.4
63 0.41
64 0.44
65 0.45
66 0.47
67 0.51
68 0.53
69 0.56
70 0.62
71 0.63
72 0.62
73 0.61
74 0.63
75 0.66
76 0.73
77 0.76
78 0.7
79 0.71
80 0.76
81 0.77
82 0.79
83 0.83
84 0.84
85 0.83
86 0.87