Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5P9E4

Protein Details
Accession J5P9E4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22RRWLTISKSGKKKKAASDTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS00972  USP_1  
PS50235  USP_3  
Amino Acid Sequences MIRRWLTISKSGKKKKAASDTITEEVEKNDFKPVNYDINDETCNSASSDNPSSSLFISNLNTKEIFFNEDNNLRPSSVQECNSETCNHGNGHYSQDEIFNMSMAKPTSTCGGGIMQAPEPPILATSVSESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSVRENILPIPGKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.8
4 0.79
5 0.74
6 0.72
7 0.71
8 0.65
9 0.59
10 0.5
11 0.4
12 0.32
13 0.3
14 0.23
15 0.17
16 0.21
17 0.21
18 0.21
19 0.24
20 0.26
21 0.31
22 0.31
23 0.34
24 0.28
25 0.3
26 0.31
27 0.27
28 0.26
29 0.19
30 0.18
31 0.16
32 0.14
33 0.12
34 0.16
35 0.18
36 0.16
37 0.17
38 0.17
39 0.17
40 0.17
41 0.18
42 0.14
43 0.13
44 0.14
45 0.18
46 0.18
47 0.19
48 0.18
49 0.17
50 0.17
51 0.16
52 0.19
53 0.15
54 0.16
55 0.18
56 0.21
57 0.22
58 0.23
59 0.23
60 0.18
61 0.18
62 0.17
63 0.18
64 0.19
65 0.2
66 0.2
67 0.21
68 0.22
69 0.24
70 0.23
71 0.2
72 0.17
73 0.17
74 0.15
75 0.14
76 0.14
77 0.14
78 0.16
79 0.15
80 0.14
81 0.12
82 0.13
83 0.12
84 0.12
85 0.1
86 0.07
87 0.07
88 0.07
89 0.09
90 0.08
91 0.08
92 0.07
93 0.08
94 0.09
95 0.1
96 0.09
97 0.08
98 0.08
99 0.09
100 0.1
101 0.11
102 0.1
103 0.1
104 0.11
105 0.1
106 0.1
107 0.08
108 0.08
109 0.07
110 0.06
111 0.06
112 0.08
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.09
121 0.09
122 0.11
123 0.12
124 0.15
125 0.14
126 0.14
127 0.15
128 0.14
129 0.21
130 0.22
131 0.23
132 0.22
133 0.23
134 0.22
135 0.22
136 0.23
137 0.17
138 0.16
139 0.16
140 0.15
141 0.2
142 0.21
143 0.22
144 0.21
145 0.21
146 0.21
147 0.23
148 0.23
149 0.21
150 0.23
151 0.22
152 0.24
153 0.23
154 0.23
155 0.2
156 0.27
157 0.26