Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166BA99

Protein Details
Accession A0A166BA99    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-92GMLWRHYTERRRRARRAALDAHydrophilic
NLS Segment(s)
PositionSequence
81-89RRRRARRAA
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, mito 5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSVSPIASSSSGDGSPAFTTSPSSSTPTAPPPPGGNDDGNDFAAEAHSSTSLLFGFLIAFLSLFVLFMLCGMLWRHYTERRRRARRAALDAVREKKLNDKIPKLWELHIENSDSADDWKQIMPLSAGIVHSSETSLDTAQEIEQDIARSNTLFDRIINFVLRLPYHYPGTTPPEPVLPVVRPKPKKDERSHVAEKQEHLQVAVLVAMPEPPRKPSSSRDASGDGSSSSQDPVPEFREYALGVTEVHWDPSRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.12
6 0.1
7 0.13
8 0.14
9 0.17
10 0.17
11 0.2
12 0.21
13 0.23
14 0.27
15 0.3
16 0.35
17 0.34
18 0.35
19 0.33
20 0.36
21 0.38
22 0.38
23 0.32
24 0.27
25 0.29
26 0.28
27 0.26
28 0.21
29 0.17
30 0.13
31 0.12
32 0.11
33 0.08
34 0.07
35 0.06
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.05
59 0.05
60 0.07
61 0.08
62 0.11
63 0.15
64 0.22
65 0.32
66 0.41
67 0.5
68 0.6
69 0.68
70 0.73
71 0.79
72 0.82
73 0.81
74 0.78
75 0.78
76 0.72
77 0.7
78 0.69
79 0.63
80 0.55
81 0.47
82 0.39
83 0.37
84 0.4
85 0.41
86 0.41
87 0.43
88 0.46
89 0.5
90 0.54
91 0.49
92 0.43
93 0.4
94 0.36
95 0.34
96 0.3
97 0.26
98 0.22
99 0.2
100 0.19
101 0.13
102 0.11
103 0.09
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.06
123 0.05
124 0.05
125 0.05
126 0.06
127 0.05
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.09
141 0.08
142 0.11
143 0.12
144 0.13
145 0.13
146 0.13
147 0.12
148 0.14
149 0.14
150 0.14
151 0.16
152 0.17
153 0.18
154 0.18
155 0.17
156 0.19
157 0.27
158 0.26
159 0.25
160 0.23
161 0.22
162 0.23
163 0.23
164 0.22
165 0.17
166 0.22
167 0.28
168 0.37
169 0.4
170 0.44
171 0.53
172 0.6
173 0.67
174 0.69
175 0.73
176 0.69
177 0.73
178 0.77
179 0.72
180 0.71
181 0.64
182 0.58
183 0.52
184 0.5
185 0.41
186 0.33
187 0.28
188 0.2
189 0.17
190 0.15
191 0.1
192 0.07
193 0.07
194 0.09
195 0.1
196 0.13
197 0.14
198 0.18
199 0.21
200 0.24
201 0.28
202 0.32
203 0.41
204 0.45
205 0.47
206 0.47
207 0.48
208 0.48
209 0.45
210 0.39
211 0.3
212 0.23
213 0.21
214 0.17
215 0.15
216 0.13
217 0.13
218 0.14
219 0.17
220 0.2
221 0.21
222 0.21
223 0.2
224 0.22
225 0.21
226 0.2
227 0.17
228 0.14
229 0.12
230 0.13
231 0.18
232 0.16
233 0.19
234 0.19