Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166B0S1

Protein Details
Accession A0A166B0S1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-127KGADGDGKKRKRTRGKAKAKKEETEEERBasic
NLS Segment(s)
PositionSequence
105-120DGKKRKRTRGKAKAKK
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MKNKNKQTKFPVARIKKIMQKDEEVGKVAQATPVVISKALELFLQHVVEASSSVTKSRGAKRVEPYHLKHAIHTTEMLDFLKEIVENVPDPTNGGAIPEKGADGDGKKRKRTRGKAKAKKEETEEERTDEGDEQEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.72
4 0.72
5 0.7
6 0.63
7 0.6
8 0.56
9 0.56
10 0.51
11 0.46
12 0.38
13 0.31
14 0.27
15 0.23
16 0.19
17 0.13
18 0.11
19 0.09
20 0.11
21 0.11
22 0.1
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.07
29 0.08
30 0.1
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.1
43 0.15
44 0.21
45 0.28
46 0.3
47 0.35
48 0.43
49 0.5
50 0.54
51 0.56
52 0.53
53 0.54
54 0.56
55 0.5
56 0.43
57 0.39
58 0.33
59 0.27
60 0.25
61 0.17
62 0.12
63 0.13
64 0.12
65 0.08
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.08
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.09
90 0.1
91 0.2
92 0.28
93 0.35
94 0.43
95 0.5
96 0.59
97 0.69
98 0.77
99 0.79
100 0.81
101 0.86
102 0.88
103 0.93
104 0.94
105 0.9
106 0.86
107 0.81
108 0.8
109 0.75
110 0.73
111 0.65
112 0.58
113 0.52
114 0.46
115 0.41
116 0.33
117 0.28