Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166H3D1

Protein Details
Accession A0A166H3D1   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-44LERARGNKYKERCRRIPLGDBasic
NLS Segment(s)
PositionSequence
69-74AKKRKK
Subcellular Location(s) nucl 8cyto_nucl 8, cyto 6, mito 5, plas 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046521  DUF6698  
Pfam View protein in Pfam  
PF20414  DUF6698  
Amino Acid Sequences MPRSWENDEDLTRLSQEQLIDRISLERARGNKYKERCRRIPLGDATNRSGNEDGGGSNDDDGAASAPPAKKRKKAASYEDIDLSVRETIKSAGRKFSVMSSLWLEQPSVTFSVPFESDFDPDTRFDSPENRIQGQLQDLYANIDTTLHSYFEKKGFQALLIEGINEQRSNSVSRIRLLCGPEIFDVKPKVMKSAALRNDAFRVLIGWKPDAIREGIASKPGYVTMAPILYKDHENGLLHKNLFMNPELLAVAQAVLWGPSSVYTDAPGATPHKTVASLWGLRCATPGLVAFCCVLAIFSLSHDLHFDPTGAATGIEYFDNFQFYLKIISDGVRHRKKAMLAVMQFWNKTLFSHTLPRSQKGGLDLTRQAALLAQEGDETASESEHEDEDQGEQEGENGGFDDHGHNGAPTDGDQLNAQDMDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.2
4 0.21
5 0.23
6 0.23
7 0.22
8 0.21
9 0.22
10 0.22
11 0.23
12 0.21
13 0.23
14 0.26
15 0.33
16 0.39
17 0.44
18 0.5
19 0.57
20 0.66
21 0.72
22 0.77
23 0.77
24 0.78
25 0.81
26 0.78
27 0.78
28 0.75
29 0.75
30 0.73
31 0.7
32 0.66
33 0.62
34 0.56
35 0.49
36 0.41
37 0.31
38 0.25
39 0.21
40 0.16
41 0.13
42 0.15
43 0.12
44 0.12
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.06
51 0.06
52 0.11
53 0.15
54 0.22
55 0.31
56 0.37
57 0.44
58 0.53
59 0.63
60 0.68
61 0.74
62 0.76
63 0.77
64 0.76
65 0.73
66 0.65
67 0.55
68 0.46
69 0.36
70 0.28
71 0.21
72 0.16
73 0.12
74 0.12
75 0.13
76 0.19
77 0.26
78 0.27
79 0.31
80 0.32
81 0.33
82 0.33
83 0.34
84 0.33
85 0.26
86 0.26
87 0.24
88 0.24
89 0.25
90 0.24
91 0.21
92 0.16
93 0.16
94 0.15
95 0.13
96 0.11
97 0.1
98 0.09
99 0.12
100 0.12
101 0.12
102 0.13
103 0.12
104 0.13
105 0.15
106 0.16
107 0.15
108 0.15
109 0.17
110 0.15
111 0.15
112 0.15
113 0.18
114 0.21
115 0.26
116 0.3
117 0.29
118 0.29
119 0.29
120 0.29
121 0.27
122 0.25
123 0.19
124 0.14
125 0.13
126 0.14
127 0.14
128 0.12
129 0.09
130 0.08
131 0.07
132 0.09
133 0.1
134 0.08
135 0.09
136 0.1
137 0.13
138 0.17
139 0.19
140 0.17
141 0.19
142 0.19
143 0.19
144 0.18
145 0.16
146 0.15
147 0.13
148 0.13
149 0.1
150 0.11
151 0.11
152 0.1
153 0.09
154 0.07
155 0.08
156 0.1
157 0.12
158 0.16
159 0.17
160 0.2
161 0.22
162 0.23
163 0.26
164 0.25
165 0.26
166 0.21
167 0.21
168 0.19
169 0.2
170 0.18
171 0.18
172 0.17
173 0.16
174 0.19
175 0.17
176 0.18
177 0.16
178 0.19
179 0.19
180 0.27
181 0.31
182 0.33
183 0.34
184 0.33
185 0.34
186 0.31
187 0.27
188 0.17
189 0.13
190 0.1
191 0.11
192 0.11
193 0.1
194 0.1
195 0.11
196 0.11
197 0.11
198 0.1
199 0.09
200 0.08
201 0.1
202 0.09
203 0.12
204 0.12
205 0.1
206 0.1
207 0.1
208 0.1
209 0.08
210 0.08
211 0.06
212 0.07
213 0.07
214 0.07
215 0.08
216 0.09
217 0.1
218 0.1
219 0.1
220 0.11
221 0.12
222 0.15
223 0.18
224 0.2
225 0.19
226 0.2
227 0.2
228 0.19
229 0.2
230 0.17
231 0.15
232 0.11
233 0.12
234 0.1
235 0.09
236 0.08
237 0.06
238 0.05
239 0.04
240 0.04
241 0.03
242 0.03
243 0.04
244 0.03
245 0.03
246 0.04
247 0.06
248 0.07
249 0.07
250 0.08
251 0.08
252 0.09
253 0.09
254 0.1
255 0.1
256 0.11
257 0.11
258 0.11
259 0.11
260 0.11
261 0.11
262 0.14
263 0.18
264 0.2
265 0.2
266 0.26
267 0.25
268 0.25
269 0.26
270 0.22
271 0.16
272 0.13
273 0.15
274 0.11
275 0.11
276 0.12
277 0.11
278 0.1
279 0.1
280 0.08
281 0.07
282 0.05
283 0.06
284 0.05
285 0.05
286 0.1
287 0.1
288 0.11
289 0.12
290 0.12
291 0.13
292 0.13
293 0.13
294 0.08
295 0.08
296 0.09
297 0.08
298 0.08
299 0.06
300 0.06
301 0.07
302 0.07
303 0.07
304 0.07
305 0.08
306 0.09
307 0.09
308 0.09
309 0.09
310 0.09
311 0.12
312 0.11
313 0.12
314 0.11
315 0.13
316 0.17
317 0.25
318 0.35
319 0.39
320 0.41
321 0.42
322 0.45
323 0.46
324 0.48
325 0.48
326 0.46
327 0.4
328 0.44
329 0.48
330 0.47
331 0.45
332 0.39
333 0.33
334 0.24
335 0.23
336 0.23
337 0.2
338 0.2
339 0.3
340 0.32
341 0.39
342 0.43
343 0.46
344 0.45
345 0.42
346 0.41
347 0.36
348 0.4
349 0.34
350 0.36
351 0.35
352 0.34
353 0.34
354 0.31
355 0.27
356 0.21
357 0.19
358 0.15
359 0.13
360 0.11
361 0.1
362 0.1
363 0.11
364 0.09
365 0.1
366 0.07
367 0.07
368 0.07
369 0.09
370 0.1
371 0.1
372 0.11
373 0.1
374 0.1
375 0.12
376 0.13
377 0.12
378 0.11
379 0.1
380 0.1
381 0.12
382 0.11
383 0.1
384 0.09
385 0.08
386 0.08
387 0.09
388 0.1
389 0.1
390 0.11
391 0.11
392 0.11
393 0.11
394 0.12
395 0.12
396 0.11
397 0.15
398 0.14
399 0.14
400 0.15
401 0.16
402 0.18
403 0.17