Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ZZ86

Protein Details
Accession A0A165ZZ86    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSTVAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQMALKRCKHFELGGDKKTKGAALTFFMNQLLMLVQYRSRTLSIPRAFTLSNLTTNEILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.89
9 0.89
10 0.89
11 0.9
12 0.86
13 0.88
14 0.87
15 0.83
16 0.79
17 0.73
18 0.64
19 0.59
20 0.57
21 0.56
22 0.56
23 0.56
24 0.55
25 0.57
26 0.59
27 0.63
28 0.66
29 0.62
30 0.62
31 0.66
32 0.67
33 0.68
34 0.67
35 0.64
36 0.62
37 0.64
38 0.55
39 0.5
40 0.46
41 0.38
42 0.4
43 0.41
44 0.39
45 0.34
46 0.4
47 0.44
48 0.52
49 0.6
50 0.62
51 0.6
52 0.63
53 0.7
54 0.7
55 0.67
56 0.62
57 0.56
58 0.52
59 0.49
60 0.44
61 0.38
62 0.35
63 0.3
64 0.25
65 0.23
66 0.23
67 0.27
68 0.32
69 0.34
70 0.38
71 0.48
72 0.54
73 0.58
74 0.56
75 0.5
76 0.46
77 0.41
78 0.4
79 0.4
80 0.41
81 0.43
82 0.45
83 0.44
84 0.42
85 0.41
86 0.36
87 0.26
88 0.2
89 0.16
90 0.15
91 0.18
92 0.17
93 0.17
94 0.16
95 0.15
96 0.13
97 0.11
98 0.08
99 0.06
100 0.07
101 0.07
102 0.09
103 0.1
104 0.12
105 0.13
106 0.14
107 0.16
108 0.2
109 0.29
110 0.33
111 0.36
112 0.36
113 0.38
114 0.37
115 0.35
116 0.37
117 0.3
118 0.3
119 0.27
120 0.29