Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166H8M2

Protein Details
Accession A0A166H8M2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDSAHRSRRHQHRSLQPTGAHydrophilic
NLS Segment(s)
PositionSequence
168-197DRDRERDRDRERDRERDSRDLKRIKSERPK
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 4.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR013890  Tscrpt_rep_Tup1_N  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Pfam View protein in Pfam  
PF08581  Tup_N  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
CDD cd00200  WD40  
Amino Acid Sequences MDSAHRSRRHQHRSLQPTGAPPQPPTNIVAHSAARLQESIEIIRQEFESLSQEASVARAQRDDLDSNVTSQVNEVNIIRQSLYELESQHAKIRQQYEEELARLRSELHAARQAIPPGGIQQPAPGMGPGPIQSNLPIPPQQMGSDRAPNSSSYVDPYYGRDKDRERSDRDRERDRDRERDRERDSRDLKRIKSERPKSDRDGRDYYSAGSSSKPPPTSGPYVGDVPPSASASTPSSALAPGTFPEDGGQTEEYRKEGSDWLAQYSSKASKRLLDVQLVHTLNHESVVCCVRFSADGKYLATGCNRTAQIYDTKTGSKVCILADDAASKTGDLYIRSVCFSPDGRYLATGAEDKQIRIWDISKKKIRTFFKGHQQEIYSLDFSRDGRLIVSGSGDRTARIWDMQTNECKILTINEPEQVDAGVTSVAISPDGRLVAAGSLDTVVRIWDVATGQLIERLNGHRDSVYSVAFTPDGKGLVSGSLDKSLKHWDVGPLLRNPVKSGEKGSQCTMNFVGHKDYVLSVAVSHDGKWVVSGSKDRCVQFWDARSAQMQVTLQGHKNSGTLLSDDFAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.72
4 0.69
5 0.66
6 0.63
7 0.55
8 0.49
9 0.48
10 0.44
11 0.42
12 0.39
13 0.37
14 0.32
15 0.32
16 0.33
17 0.27
18 0.25
19 0.27
20 0.25
21 0.23
22 0.21
23 0.18
24 0.18
25 0.19
26 0.2
27 0.2
28 0.21
29 0.2
30 0.21
31 0.21
32 0.19
33 0.17
34 0.16
35 0.16
36 0.15
37 0.15
38 0.14
39 0.14
40 0.12
41 0.14
42 0.16
43 0.15
44 0.15
45 0.16
46 0.16
47 0.2
48 0.25
49 0.24
50 0.23
51 0.26
52 0.25
53 0.26
54 0.29
55 0.25
56 0.2
57 0.19
58 0.2
59 0.14
60 0.16
61 0.14
62 0.15
63 0.16
64 0.17
65 0.16
66 0.14
67 0.15
68 0.15
69 0.17
70 0.15
71 0.15
72 0.17
73 0.21
74 0.22
75 0.26
76 0.28
77 0.28
78 0.32
79 0.36
80 0.38
81 0.37
82 0.39
83 0.4
84 0.4
85 0.39
86 0.36
87 0.32
88 0.28
89 0.25
90 0.23
91 0.18
92 0.19
93 0.19
94 0.21
95 0.27
96 0.28
97 0.31
98 0.34
99 0.35
100 0.3
101 0.28
102 0.24
103 0.21
104 0.21
105 0.19
106 0.15
107 0.15
108 0.14
109 0.15
110 0.15
111 0.11
112 0.09
113 0.09
114 0.11
115 0.1
116 0.12
117 0.12
118 0.12
119 0.13
120 0.15
121 0.16
122 0.18
123 0.19
124 0.17
125 0.18
126 0.19
127 0.2
128 0.21
129 0.24
130 0.24
131 0.3
132 0.29
133 0.3
134 0.29
135 0.28
136 0.28
137 0.25
138 0.21
139 0.17
140 0.19
141 0.19
142 0.19
143 0.21
144 0.26
145 0.27
146 0.29
147 0.3
148 0.32
149 0.39
150 0.48
151 0.52
152 0.53
153 0.58
154 0.67
155 0.71
156 0.74
157 0.76
158 0.72
159 0.73
160 0.76
161 0.73
162 0.73
163 0.7
164 0.74
165 0.7
166 0.73
167 0.71
168 0.7
169 0.69
170 0.69
171 0.69
172 0.67
173 0.7
174 0.68
175 0.63
176 0.65
177 0.65
178 0.64
179 0.69
180 0.7
181 0.71
182 0.71
183 0.75
184 0.72
185 0.77
186 0.74
187 0.7
188 0.66
189 0.58
190 0.54
191 0.48
192 0.43
193 0.34
194 0.28
195 0.22
196 0.17
197 0.18
198 0.18
199 0.23
200 0.22
201 0.21
202 0.23
203 0.28
204 0.32
205 0.31
206 0.29
207 0.26
208 0.28
209 0.27
210 0.25
211 0.2
212 0.16
213 0.14
214 0.12
215 0.1
216 0.08
217 0.09
218 0.1
219 0.1
220 0.1
221 0.09
222 0.09
223 0.09
224 0.09
225 0.07
226 0.06
227 0.06
228 0.08
229 0.07
230 0.07
231 0.07
232 0.08
233 0.08
234 0.09
235 0.1
236 0.09
237 0.11
238 0.11
239 0.11
240 0.11
241 0.11
242 0.1
243 0.11
244 0.13
245 0.15
246 0.15
247 0.17
248 0.17
249 0.17
250 0.16
251 0.17
252 0.2
253 0.18
254 0.2
255 0.18
256 0.2
257 0.23
258 0.31
259 0.3
260 0.29
261 0.28
262 0.28
263 0.35
264 0.32
265 0.29
266 0.22
267 0.2
268 0.16
269 0.15
270 0.13
271 0.06
272 0.08
273 0.11
274 0.1
275 0.09
276 0.09
277 0.09
278 0.1
279 0.11
280 0.13
281 0.14
282 0.15
283 0.16
284 0.17
285 0.16
286 0.17
287 0.16
288 0.14
289 0.11
290 0.14
291 0.14
292 0.14
293 0.14
294 0.15
295 0.19
296 0.19
297 0.21
298 0.17
299 0.18
300 0.18
301 0.19
302 0.17
303 0.13
304 0.12
305 0.11
306 0.1
307 0.11
308 0.11
309 0.11
310 0.11
311 0.11
312 0.1
313 0.1
314 0.08
315 0.07
316 0.08
317 0.09
318 0.08
319 0.09
320 0.11
321 0.11
322 0.13
323 0.13
324 0.11
325 0.12
326 0.13
327 0.14
328 0.16
329 0.17
330 0.16
331 0.17
332 0.17
333 0.15
334 0.15
335 0.13
336 0.1
337 0.14
338 0.14
339 0.14
340 0.15
341 0.16
342 0.15
343 0.15
344 0.17
345 0.22
346 0.27
347 0.37
348 0.43
349 0.46
350 0.5
351 0.58
352 0.6
353 0.59
354 0.62
355 0.6
356 0.63
357 0.68
358 0.64
359 0.6
360 0.56
361 0.5
362 0.44
363 0.39
364 0.29
365 0.2
366 0.2
367 0.17
368 0.16
369 0.17
370 0.14
371 0.11
372 0.11
373 0.11
374 0.11
375 0.09
376 0.11
377 0.09
378 0.1
379 0.12
380 0.11
381 0.11
382 0.11
383 0.12
384 0.11
385 0.12
386 0.12
387 0.13
388 0.18
389 0.23
390 0.27
391 0.28
392 0.28
393 0.26
394 0.25
395 0.22
396 0.21
397 0.2
398 0.2
399 0.19
400 0.22
401 0.22
402 0.22
403 0.22
404 0.19
405 0.15
406 0.1
407 0.09
408 0.05
409 0.04
410 0.05
411 0.05
412 0.05
413 0.06
414 0.06
415 0.06
416 0.07
417 0.07
418 0.07
419 0.06
420 0.06
421 0.06
422 0.06
423 0.06
424 0.05
425 0.05
426 0.05
427 0.05
428 0.05
429 0.05
430 0.04
431 0.05
432 0.04
433 0.06
434 0.06
435 0.07
436 0.08
437 0.08
438 0.08
439 0.13
440 0.13
441 0.11
442 0.14
443 0.16
444 0.19
445 0.2
446 0.21
447 0.17
448 0.17
449 0.21
450 0.2
451 0.18
452 0.15
453 0.15
454 0.15
455 0.15
456 0.15
457 0.13
458 0.12
459 0.12
460 0.11
461 0.11
462 0.1
463 0.1
464 0.11
465 0.12
466 0.12
467 0.18
468 0.18
469 0.18
470 0.2
471 0.26
472 0.27
473 0.26
474 0.27
475 0.25
476 0.31
477 0.36
478 0.4
479 0.35
480 0.41
481 0.43
482 0.41
483 0.38
484 0.39
485 0.39
486 0.35
487 0.37
488 0.39
489 0.43
490 0.46
491 0.47
492 0.47
493 0.43
494 0.45
495 0.41
496 0.38
497 0.33
498 0.32
499 0.34
500 0.27
501 0.27
502 0.24
503 0.22
504 0.18
505 0.17
506 0.15
507 0.1
508 0.11
509 0.14
510 0.13
511 0.13
512 0.15
513 0.14
514 0.14
515 0.15
516 0.15
517 0.14
518 0.17
519 0.25
520 0.26
521 0.33
522 0.39
523 0.39
524 0.39
525 0.41
526 0.45
527 0.44
528 0.47
529 0.48
530 0.43
531 0.45
532 0.45
533 0.43
534 0.36
535 0.34
536 0.28
537 0.24
538 0.27
539 0.3
540 0.33
541 0.34
542 0.35
543 0.3
544 0.3
545 0.27
546 0.25
547 0.21
548 0.18
549 0.17