Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4TSQ4

Protein Details
Accession J4TSQ4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-91LARAKSKQGSKILKRRKLKGRWFLSHHydrophilic
NLS Segment(s)
PositionSequence
58-86KRKRTFGFLARAKSKQGSKILKRRKLKGR
Subcellular Location(s) mito 19.5, cyto_mito 11.333, nucl 4.5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLSSISSFSALSVLRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.19
5 0.21
6 0.21
7 0.17
8 0.18
9 0.21
10 0.24
11 0.24
12 0.22
13 0.21
14 0.2
15 0.19
16 0.16
17 0.15
18 0.16
19 0.15
20 0.14
21 0.13
22 0.12
23 0.12
24 0.1
25 0.1
26 0.07
27 0.1
28 0.12
29 0.16
30 0.19
31 0.23
32 0.28
33 0.3
34 0.39
35 0.47
36 0.53
37 0.57
38 0.57
39 0.62
40 0.59
41 0.61
42 0.61
43 0.57
44 0.58
45 0.55
46 0.6
47 0.53
48 0.57
49 0.58
50 0.55
51 0.58
52 0.55
53 0.58
54 0.56
55 0.56
56 0.52
57 0.51
58 0.48
59 0.45
60 0.48
61 0.51
62 0.56
63 0.65
64 0.73
65 0.77
66 0.82
67 0.85
68 0.86
69 0.86
70 0.87
71 0.87