Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166CN77

Protein Details
Accession A0A166CN77    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-36SSSSGGKAAKKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
11-30SSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPSSSSGGKAAKKKKWSKGKVKDKAQHAVILDKATYDRIMKEVPTFRFISQSILIERLKVNGSLARTAIRHLEKEGLIKRIVHHNGQLIYSAFLSYPFFYPSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.48
5 0.56
6 0.63
7 0.71
8 0.78
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.81
18 0.71
19 0.64
20 0.53
21 0.46
22 0.37
23 0.31
24 0.24
25 0.17
26 0.15
27 0.12
28 0.12
29 0.1
30 0.09
31 0.09
32 0.1
33 0.11
34 0.15
35 0.2
36 0.2
37 0.23
38 0.24
39 0.22
40 0.24
41 0.24
42 0.22
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.15
49 0.15
50 0.14
51 0.13
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.13
60 0.14
61 0.19
62 0.19
63 0.19
64 0.19
65 0.22
66 0.21
67 0.28
68 0.31
69 0.28
70 0.27
71 0.27
72 0.28
73 0.34
74 0.37
75 0.32
76 0.32
77 0.34
78 0.34
79 0.34
80 0.34
81 0.25
82 0.23
83 0.2
84 0.17
85 0.12
86 0.11
87 0.13
88 0.12
89 0.13