Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165WI96

Protein Details
Accession A0A165WI96    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
143-168EDNATGKGRAKPRKRKAAGKSGPSTAHydrophilic
NLS Segment(s)
PositionSequence
149-175KGRAKPRKRKAAGKSGPSTAAKRVRSK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MTSNCSPVTTPPRPAVACTEALDTSHTDLEDLANEDSDSNASEQPSLHDSSGSDIEEDDTPEQPIDNGTRRSTRSRNRNPVADLSRSLVESHTCADDACLGEGVSGVMVKCGGPACVRPYYHIECAGFTEIPPKGFFCDAVCEDNATGKGRAKPRKRKAAGKSGPSTAAKRVRSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.39
4 0.36
5 0.33
6 0.32
7 0.25
8 0.25
9 0.25
10 0.19
11 0.18
12 0.16
13 0.14
14 0.12
15 0.11
16 0.12
17 0.12
18 0.13
19 0.11
20 0.1
21 0.1
22 0.1
23 0.1
24 0.1
25 0.09
26 0.08
27 0.09
28 0.09
29 0.1
30 0.1
31 0.12
32 0.15
33 0.16
34 0.14
35 0.13
36 0.13
37 0.15
38 0.17
39 0.15
40 0.12
41 0.1
42 0.12
43 0.12
44 0.13
45 0.11
46 0.1
47 0.1
48 0.1
49 0.09
50 0.08
51 0.09
52 0.11
53 0.14
54 0.17
55 0.18
56 0.22
57 0.25
58 0.32
59 0.39
60 0.44
61 0.51
62 0.59
63 0.67
64 0.67
65 0.69
66 0.65
67 0.64
68 0.59
69 0.5
70 0.4
71 0.32
72 0.28
73 0.24
74 0.22
75 0.14
76 0.11
77 0.09
78 0.09
79 0.08
80 0.07
81 0.07
82 0.07
83 0.08
84 0.08
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.06
100 0.06
101 0.09
102 0.13
103 0.18
104 0.18
105 0.2
106 0.26
107 0.3
108 0.32
109 0.33
110 0.3
111 0.25
112 0.28
113 0.28
114 0.22
115 0.17
116 0.2
117 0.17
118 0.18
119 0.18
120 0.16
121 0.16
122 0.17
123 0.17
124 0.13
125 0.18
126 0.19
127 0.22
128 0.21
129 0.2
130 0.2
131 0.22
132 0.23
133 0.2
134 0.2
135 0.21
136 0.27
137 0.35
138 0.45
139 0.53
140 0.62
141 0.7
142 0.79
143 0.83
144 0.86
145 0.87
146 0.88
147 0.87
148 0.85
149 0.8
150 0.73
151 0.71
152 0.66
153 0.59
154 0.56
155 0.56