Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8TY71

Protein Details
Accession J8TY71   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-79IAENKIYKLKKVKRNRKQVILQQHEIHydrophilic
NLS Segment(s)
PositionSequence
63-68KKVKRN
Subcellular Location(s) nucl 18.5, cyto_nucl 15.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031590  PRP9_N  
Pfam View protein in Pfam  
PF16958  PRP9_N  
Amino Acid Sequences MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.12
5 0.12
6 0.09
7 0.08
8 0.06
9 0.05
10 0.07
11 0.1
12 0.13
13 0.15
14 0.18
15 0.19
16 0.2
17 0.26
18 0.27
19 0.26
20 0.25
21 0.24
22 0.23
23 0.22
24 0.26
25 0.21
26 0.19
27 0.18
28 0.18
29 0.17
30 0.16
31 0.25
32 0.26
33 0.3
34 0.34
35 0.33
36 0.32
37 0.34
38 0.34
39 0.3
40 0.28
41 0.26
42 0.25
43 0.28
44 0.3
45 0.33
46 0.33
47 0.31
48 0.38
49 0.44
50 0.5
51 0.57
52 0.66
53 0.7
54 0.82
55 0.86
56 0.85
57 0.85
58 0.83
59 0.83
60 0.8
61 0.74
62 0.64
63 0.57
64 0.48
65 0.4
66 0.32
67 0.23
68 0.15
69 0.12
70 0.13
71 0.14
72 0.17
73 0.24
74 0.32
75 0.3
76 0.32
77 0.4
78 0.48
79 0.5