Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8THV4

Protein Details
Accession J8THV4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
202-246PNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKSSTNKSAINGHydrophilic
NLS Segment(s)
PositionSequence
188-237KESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKS
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04900  Fcf1  
CDD cd09865  PIN_ScUtp23p-like  
Amino Acid Sequences MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKSSTNKSAINGTTVLQVQPSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.63
4 0.57
5 0.55
6 0.52
7 0.47
8 0.43
9 0.4
10 0.42
11 0.38
12 0.39
13 0.39
14 0.45
15 0.44
16 0.43
17 0.41
18 0.31
19 0.29
20 0.25
21 0.19
22 0.13
23 0.13
24 0.09
25 0.08
26 0.1
27 0.11
28 0.13
29 0.13
30 0.13
31 0.16
32 0.16
33 0.19
34 0.22
35 0.25
36 0.24
37 0.25
38 0.27
39 0.29
40 0.33
41 0.31
42 0.29
43 0.27
44 0.27
45 0.27
46 0.25
47 0.2
48 0.17
49 0.16
50 0.14
51 0.13
52 0.12
53 0.1
54 0.13
55 0.16
56 0.18
57 0.19
58 0.2
59 0.19
60 0.2
61 0.2
62 0.16
63 0.14
64 0.12
65 0.1
66 0.1
67 0.11
68 0.11
69 0.15
70 0.19
71 0.24
72 0.3
73 0.33
74 0.4
75 0.47
76 0.55
77 0.58
78 0.65
79 0.69
80 0.66
81 0.73
82 0.69
83 0.66
84 0.61
85 0.56
86 0.46
87 0.41
88 0.37
89 0.27
90 0.24
91 0.19
92 0.15
93 0.14
94 0.12
95 0.07
96 0.08
97 0.1
98 0.1
99 0.1
100 0.11
101 0.11
102 0.12
103 0.12
104 0.12
105 0.12
106 0.15
107 0.16
108 0.16
109 0.24
110 0.26
111 0.27
112 0.3
113 0.28
114 0.24
115 0.28
116 0.31
117 0.28
118 0.32
119 0.33
120 0.33
121 0.39
122 0.39
123 0.34
124 0.33
125 0.28
126 0.22
127 0.2
128 0.16
129 0.09
130 0.09
131 0.09
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.05
141 0.07
142 0.13
143 0.13
144 0.16
145 0.18
146 0.21
147 0.29
148 0.35
149 0.42
150 0.46
151 0.49
152 0.51
153 0.56
154 0.54
155 0.47
156 0.47
157 0.41
158 0.39
159 0.4
160 0.37
161 0.33
162 0.35
163 0.35
164 0.28
165 0.29
166 0.26
167 0.22
168 0.24
169 0.23
170 0.22
171 0.24
172 0.27
173 0.25
174 0.21
175 0.26
176 0.27
177 0.35
178 0.42
179 0.45
180 0.48
181 0.55
182 0.63
183 0.68
184 0.73
185 0.73
186 0.75
187 0.79
188 0.78
189 0.78
190 0.75
191 0.75
192 0.74
193 0.74
194 0.71
195 0.67
196 0.71
197 0.7
198 0.75
199 0.77
200 0.77
201 0.77
202 0.8
203 0.81
204 0.78
205 0.73
206 0.64
207 0.57
208 0.48
209 0.39
210 0.33
211 0.33
212 0.34
213 0.38
214 0.46
215 0.49
216 0.57
217 0.67
218 0.75
219 0.78
220 0.83
221 0.88
222 0.89
223 0.94
224 0.95
225 0.95
226 0.93
227 0.88
228 0.79
229 0.75
230 0.65
231 0.57
232 0.46
233 0.36
234 0.31
235 0.26
236 0.25
237 0.18