Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WDE1

Protein Details
Accession A0A165WDE1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-87PTPPPPPLFKKKRIIKKTKRVIKKKKRVIKKNKKKKTGCLVLSPNKEFBasic
NLS Segment(s)
PositionSequence
46-75PLFKKKRIIKKTKRVIKKKKRVIKKNKKKK
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MPDSFNFNFRPPLSFLARPPTPSISLLVSIVRGSFALHLPTPPPPPLFKKKRIIKKTKRVIKKKKRVIKKNKKKKTGCLVLSPNKEFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.38
4 0.39
5 0.37
6 0.38
7 0.36
8 0.32
9 0.29
10 0.28
11 0.21
12 0.2
13 0.19
14 0.16
15 0.13
16 0.11
17 0.1
18 0.08
19 0.06
20 0.06
21 0.06
22 0.07
23 0.08
24 0.08
25 0.09
26 0.09
27 0.12
28 0.14
29 0.15
30 0.15
31 0.16
32 0.22
33 0.32
34 0.38
35 0.44
36 0.52
37 0.59
38 0.68
39 0.76
40 0.81
41 0.82
42 0.85
43 0.88
44 0.88
45 0.9
46 0.9
47 0.91
48 0.92
49 0.92
50 0.92
51 0.91
52 0.92
53 0.93
54 0.93
55 0.93
56 0.94
57 0.94
58 0.94
59 0.95
60 0.92
61 0.91
62 0.9
63 0.89
64 0.83
65 0.82
66 0.81
67 0.8
68 0.81