Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166BW72

Protein Details
Accession A0A166BW72   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-125SGAPLSKSAKKREKAKEKKKEEKERIIKDSWBasic
NLS Segment(s)
PositionSequence
88-88K
93-119GPSGAPLSKSAKKREKAKEKKKEEKER
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSLPPINPDRTASGIIVDPRTLDRVVPPTKRADGSVRKEIKIRPGFTPQEDVSRFRGTRQQQFERTQLPKGHILGWVPPSSETNPKKKAETTGPSGAPLSKSAKKREKAKEKKKEEKERIIKDSWEDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.23
4 0.2
5 0.18
6 0.17
7 0.19
8 0.18
9 0.15
10 0.15
11 0.22
12 0.29
13 0.32
14 0.34
15 0.36
16 0.39
17 0.4
18 0.39
19 0.39
20 0.42
21 0.45
22 0.52
23 0.51
24 0.49
25 0.52
26 0.52
27 0.53
28 0.51
29 0.46
30 0.4
31 0.44
32 0.46
33 0.44
34 0.47
35 0.37
36 0.37
37 0.36
38 0.35
39 0.31
40 0.33
41 0.32
42 0.28
43 0.34
44 0.32
45 0.38
46 0.43
47 0.46
48 0.47
49 0.51
50 0.53
51 0.52
52 0.49
53 0.45
54 0.4
55 0.36
56 0.32
57 0.29
58 0.27
59 0.22
60 0.2
61 0.18
62 0.19
63 0.17
64 0.15
65 0.14
66 0.15
67 0.16
68 0.25
69 0.27
70 0.33
71 0.39
72 0.4
73 0.43
74 0.43
75 0.46
76 0.45
77 0.46
78 0.45
79 0.45
80 0.43
81 0.42
82 0.4
83 0.36
84 0.28
85 0.25
86 0.25
87 0.25
88 0.3
89 0.39
90 0.48
91 0.54
92 0.63
93 0.71
94 0.77
95 0.81
96 0.87
97 0.88
98 0.9
99 0.93
100 0.94
101 0.94
102 0.93
103 0.93
104 0.92
105 0.9
106 0.86
107 0.79
108 0.71
109 0.65
110 0.6