Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166HBF8

Protein Details
Accession A0A166HBF8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-40EHIKRHGRRLDYFERKRKRIARESHKSSATBasic
NLS Segment(s)
PositionSequence
17-64GRRLDYFERKRKRIARESHKSSATAQKLFGLKAKILHAKRHAEKIQLK
111-116KRKDKA
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11381  NSA2  
Amino Acid Sequences MVCPQNEYIEEHIKRHGRRLDYFERKRKRIARESHKSSATAQKLFGLKAKILHAKRHAEKIQLKKTLKAHDERDVKQSDPSSSSKEALPTYLLDRDTQKDAKALSSAIKQKRKDKAAKYSVPLPKVRGIAEEEMFRVMKTGKSKSKAWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKKANVTHPDLKATFQLQIIGVKKNPQSPMYTQLGVMTKGTIIEVNVSELGMVTAGGKVVFGKYAQVTNNPENDGCINAVLRQYFLILRLKLLICLLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.53
4 0.5
5 0.54
6 0.61
7 0.64
8 0.68
9 0.77
10 0.78
11 0.81
12 0.79
13 0.82
14 0.81
15 0.8
16 0.79
17 0.8
18 0.8
19 0.81
20 0.85
21 0.84
22 0.78
23 0.7
24 0.64
25 0.63
26 0.58
27 0.49
28 0.41
29 0.38
30 0.38
31 0.37
32 0.37
33 0.3
34 0.25
35 0.27
36 0.32
37 0.35
38 0.36
39 0.43
40 0.46
41 0.52
42 0.56
43 0.62
44 0.59
45 0.59
46 0.64
47 0.67
48 0.69
49 0.69
50 0.66
51 0.63
52 0.66
53 0.66
54 0.64
55 0.6
56 0.56
57 0.56
58 0.62
59 0.58
60 0.59
61 0.52
62 0.47
63 0.44
64 0.41
65 0.34
66 0.3
67 0.3
68 0.29
69 0.28
70 0.29
71 0.26
72 0.26
73 0.24
74 0.21
75 0.2
76 0.15
77 0.16
78 0.18
79 0.17
80 0.16
81 0.18
82 0.2
83 0.23
84 0.23
85 0.22
86 0.2
87 0.2
88 0.2
89 0.18
90 0.16
91 0.14
92 0.19
93 0.26
94 0.32
95 0.39
96 0.43
97 0.5
98 0.57
99 0.63
100 0.66
101 0.66
102 0.68
103 0.7
104 0.71
105 0.66
106 0.67
107 0.63
108 0.58
109 0.52
110 0.44
111 0.38
112 0.35
113 0.32
114 0.25
115 0.23
116 0.21
117 0.21
118 0.19
119 0.15
120 0.15
121 0.14
122 0.12
123 0.1
124 0.08
125 0.1
126 0.13
127 0.19
128 0.23
129 0.27
130 0.33
131 0.42
132 0.52
133 0.59
134 0.61
135 0.63
136 0.63
137 0.68
138 0.7
139 0.62
140 0.54
141 0.48
142 0.43
143 0.35
144 0.29
145 0.21
146 0.16
147 0.16
148 0.14
149 0.16
150 0.17
151 0.16
152 0.19
153 0.24
154 0.29
155 0.36
156 0.41
157 0.44
158 0.48
159 0.49
160 0.5
161 0.45
162 0.44
163 0.45
164 0.45
165 0.41
166 0.38
167 0.44
168 0.46
169 0.48
170 0.51
171 0.47
172 0.49
173 0.53
174 0.51
175 0.5
176 0.44
177 0.42
178 0.36
179 0.31
180 0.25
181 0.18
182 0.18
183 0.14
184 0.18
185 0.2
186 0.2
187 0.2
188 0.24
189 0.26
190 0.3
191 0.32
192 0.29
193 0.31
194 0.31
195 0.37
196 0.36
197 0.34
198 0.29
199 0.3
200 0.3
201 0.26
202 0.24
203 0.17
204 0.12
205 0.12
206 0.12
207 0.09
208 0.07
209 0.08
210 0.08
211 0.1
212 0.1
213 0.09
214 0.09
215 0.08
216 0.08
217 0.06
218 0.05
219 0.04
220 0.04
221 0.05
222 0.04
223 0.05
224 0.05
225 0.06
226 0.07
227 0.06
228 0.09
229 0.11
230 0.16
231 0.17
232 0.23
233 0.29
234 0.34
235 0.37
236 0.37
237 0.35
238 0.33
239 0.32
240 0.28
241 0.22
242 0.18
243 0.15
244 0.15
245 0.18
246 0.16
247 0.16
248 0.14
249 0.15
250 0.15
251 0.18
252 0.23
253 0.2
254 0.21
255 0.26
256 0.26
257 0.25
258 0.25