Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WNQ0

Protein Details
Accession A0A165WNQ0    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
137-156LSSPTEKDRKDRKREAESSRBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences GRSASGISVLAIHGHLLDSSLSPLALRLDSGANVSLISESFYSSILTPPKLQKGIRLRLIQLTSSTCRVKGFIQGRIFVRDSRDRLVSLDLEAYVVSGMTVPVLLGEDFQQNYELRIAHHHDSPSEVVVGNTDHMFLSSPTEKDRKDRKREAESSRILRAGQEVVIPGHHSKRVSLAGPFDEKSTWLVESNILHLPDRTRLLVPHTILNASDPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.09
8 0.08
9 0.08
10 0.09
11 0.1
12 0.09
13 0.09
14 0.09
15 0.1
16 0.1
17 0.12
18 0.12
19 0.1
20 0.1
21 0.1
22 0.08
23 0.07
24 0.08
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.09
31 0.13
32 0.15
33 0.16
34 0.2
35 0.24
36 0.3
37 0.34
38 0.34
39 0.38
40 0.45
41 0.52
42 0.55
43 0.53
44 0.49
45 0.5
46 0.51
47 0.43
48 0.36
49 0.32
50 0.26
51 0.28
52 0.27
53 0.22
54 0.21
55 0.22
56 0.2
57 0.25
58 0.27
59 0.29
60 0.31
61 0.34
62 0.36
63 0.38
64 0.39
65 0.31
66 0.32
67 0.31
68 0.31
69 0.29
70 0.29
71 0.25
72 0.25
73 0.26
74 0.21
75 0.15
76 0.13
77 0.1
78 0.09
79 0.08
80 0.07
81 0.05
82 0.04
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.02
90 0.03
91 0.03
92 0.03
93 0.04
94 0.06
95 0.06
96 0.06
97 0.08
98 0.08
99 0.09
100 0.1
101 0.09
102 0.08
103 0.12
104 0.15
105 0.16
106 0.18
107 0.18
108 0.17
109 0.18
110 0.19
111 0.16
112 0.13
113 0.11
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.1
125 0.12
126 0.13
127 0.16
128 0.2
129 0.21
130 0.29
131 0.4
132 0.46
133 0.53
134 0.62
135 0.67
136 0.73
137 0.81
138 0.8
139 0.78
140 0.76
141 0.71
142 0.65
143 0.57
144 0.47
145 0.39
146 0.33
147 0.25
148 0.18
149 0.14
150 0.12
151 0.11
152 0.11
153 0.13
154 0.14
155 0.15
156 0.18
157 0.17
158 0.17
159 0.21
160 0.24
161 0.24
162 0.25
163 0.25
164 0.26
165 0.3
166 0.3
167 0.27
168 0.24
169 0.22
170 0.21
171 0.19
172 0.16
173 0.13
174 0.14
175 0.16
176 0.16
177 0.19
178 0.21
179 0.2
180 0.2
181 0.2
182 0.22
183 0.24
184 0.26
185 0.26
186 0.23
187 0.24
188 0.29
189 0.34
190 0.34
191 0.34
192 0.33
193 0.31
194 0.3
195 0.3