Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WMY0

Protein Details
Accession A0A165WMY0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-107HPKYKLEYFRAKKWKKKWIKQAEAIVREIHydrophilic
NLS Segment(s)
PositionSequence
89-96AKKWKKKW
Subcellular Location(s) cyto 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences VQTFKDCTVSLSVANTPLIHQVIPVIDHLTTKLANAADDESGATSLIVRHGSANGVEVLNKYYSKTDESVMYRVAMVLHPKYKLEYFRAKKWKKKWIKQAEAIVREIWKRDYLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.15
4 0.17
5 0.17
6 0.14
7 0.12
8 0.12
9 0.12
10 0.12
11 0.12
12 0.1
13 0.09
14 0.09
15 0.1
16 0.11
17 0.1
18 0.09
19 0.11
20 0.1
21 0.1
22 0.11
23 0.11
24 0.09
25 0.1
26 0.1
27 0.07
28 0.07
29 0.06
30 0.05
31 0.04
32 0.04
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.12
52 0.12
53 0.12
54 0.16
55 0.19
56 0.2
57 0.19
58 0.18
59 0.16
60 0.15
61 0.14
62 0.11
63 0.12
64 0.14
65 0.16
66 0.16
67 0.17
68 0.19
69 0.22
70 0.25
71 0.28
72 0.35
73 0.38
74 0.48
75 0.58
76 0.64
77 0.7
78 0.76
79 0.8
80 0.81
81 0.85
82 0.86
83 0.87
84 0.88
85 0.87
86 0.89
87 0.87
88 0.8
89 0.72
90 0.63
91 0.56
92 0.48
93 0.42
94 0.35