Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166H482

Protein Details
Accession A0A166H482   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
141-166FLPSAMPRSYHRRRRGRPRELVFILSHydrophilic
NLS Segment(s)
PositionSequence
152-157RRRRGR
Subcellular Location(s) nucl 13, cyto 6, mito 5, pero 2
Family & Domain DBs
Amino Acid Sequences MGYALSCTTTVLKVQWPGISWIAHGSIDHCTRRRTMYDVKTLAELDAFVCLQATSRSTFDINDSLFLAQVLQGNSYIPRTFERSSLTTRSLNWNHACARRRCGAALRLRAQPVLSGSTISHSSLPFLSHYPLSFPVHSCLFLPSAMPRSYHRRRRGRPRELVFILSGERDLEHDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.26
5 0.27
6 0.25
7 0.22
8 0.2
9 0.19
10 0.17
11 0.16
12 0.13
13 0.17
14 0.22
15 0.27
16 0.28
17 0.29
18 0.31
19 0.35
20 0.36
21 0.37
22 0.41
23 0.43
24 0.49
25 0.49
26 0.48
27 0.45
28 0.43
29 0.37
30 0.27
31 0.2
32 0.1
33 0.09
34 0.08
35 0.06
36 0.06
37 0.05
38 0.06
39 0.07
40 0.08
41 0.09
42 0.09
43 0.11
44 0.11
45 0.12
46 0.13
47 0.16
48 0.15
49 0.13
50 0.14
51 0.12
52 0.11
53 0.11
54 0.09
55 0.06
56 0.09
57 0.08
58 0.07
59 0.07
60 0.08
61 0.09
62 0.1
63 0.09
64 0.08
65 0.09
66 0.14
67 0.15
68 0.16
69 0.19
70 0.2
71 0.24
72 0.26
73 0.27
74 0.23
75 0.23
76 0.3
77 0.28
78 0.31
79 0.28
80 0.29
81 0.3
82 0.35
83 0.41
84 0.35
85 0.38
86 0.37
87 0.37
88 0.35
89 0.35
90 0.36
91 0.38
92 0.43
93 0.42
94 0.42
95 0.42
96 0.41
97 0.36
98 0.3
99 0.23
100 0.18
101 0.14
102 0.11
103 0.1
104 0.12
105 0.13
106 0.13
107 0.13
108 0.1
109 0.11
110 0.11
111 0.12
112 0.11
113 0.12
114 0.13
115 0.13
116 0.13
117 0.14
118 0.18
119 0.2
120 0.2
121 0.2
122 0.22
123 0.22
124 0.22
125 0.21
126 0.18
127 0.16
128 0.15
129 0.14
130 0.14
131 0.19
132 0.2
133 0.21
134 0.23
135 0.32
136 0.43
137 0.52
138 0.59
139 0.64
140 0.73
141 0.83
142 0.9
143 0.91
144 0.91
145 0.88
146 0.88
147 0.8
148 0.73
149 0.63
150 0.53
151 0.44
152 0.34
153 0.27
154 0.18
155 0.15