Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165XXP3

Protein Details
Accession A0A165XXP3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-70TAQQRHEKEGPKRRRLRSERWRRRFAEBasic
NLS Segment(s)
PositionSequence
50-87EKEGPKRRRLRSERWRRRFAEEVRKKVRLVEAIRRRGA
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences QAKNPKPDNAYSGRSIQIKDGELSSAWMYLQRILRDNNVRAEATAQQRHEKEGPKRRRLRSERWRRRFAEEVRKKVRLVEAIRRRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.34
4 0.31
5 0.28
6 0.26
7 0.23
8 0.2
9 0.17
10 0.18
11 0.15
12 0.11
13 0.09
14 0.1
15 0.1
16 0.13
17 0.16
18 0.16
19 0.19
20 0.2
21 0.26
22 0.3
23 0.32
24 0.31
25 0.3
26 0.28
27 0.25
28 0.25
29 0.24
30 0.24
31 0.25
32 0.23
33 0.26
34 0.27
35 0.3
36 0.32
37 0.35
38 0.39
39 0.46
40 0.55
41 0.61
42 0.7
43 0.73
44 0.8
45 0.8
46 0.82
47 0.83
48 0.84
49 0.85
50 0.85
51 0.88
52 0.8
53 0.8
54 0.78
55 0.76
56 0.76
57 0.75
58 0.75
59 0.74
60 0.75
61 0.67
62 0.63
63 0.59
64 0.56
65 0.53
66 0.54
67 0.56