Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166I6I2

Protein Details
Accession A0A166I6I2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
32-59VEPQADKKKTPKGRAKKRILYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
25-50VKSQTPKVEPQADKKKTPKGRAKKRI
Subcellular Location(s) mito 13.5, mito_nucl 11, nucl 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences VHRSLLHHFKNMGKVHGSLARAGKVKSQTPKVEPQADKKKTPKGRAKKRILYNRRFVNVTTLPGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.35
4 0.32
5 0.27
6 0.27
7 0.27
8 0.27
9 0.26
10 0.27
11 0.26
12 0.31
13 0.34
14 0.38
15 0.38
16 0.4
17 0.48
18 0.48
19 0.53
20 0.49
21 0.53
22 0.57
23 0.56
24 0.58
25 0.55
26 0.6
27 0.59
28 0.67
29 0.68
30 0.68
31 0.76
32 0.81
33 0.86
34 0.85
35 0.88
36 0.89
37 0.89
38 0.87
39 0.85
40 0.83
41 0.77
42 0.69
43 0.6
44 0.57
45 0.49
46 0.44
47 0.39
48 0.34
49 0.32