Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166FL33

Protein Details
Accession A0A166FL33    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-35GAHRVHNQSKRVRERSKRCRSKNPTKTGLRBasic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTDKDGAHRVHNQSKRVRERSKRCRSKNPTKTGLRAEACVEGADIPSSRKYPPESDHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.74
4 0.76
5 0.77
6 0.82
7 0.86
8 0.89
9 0.9
10 0.87
11 0.89
12 0.89
13 0.89
14 0.88
15 0.86
16 0.83
17 0.77
18 0.74
19 0.68
20 0.66
21 0.55
22 0.47
23 0.4
24 0.32
25 0.28
26 0.23
27 0.18
28 0.11
29 0.1
30 0.1
31 0.09
32 0.09
33 0.12
34 0.13
35 0.14
36 0.18
37 0.22
38 0.28