Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166DEV0

Protein Details
Accession A0A166DEV0   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-99NSAFLPVRRPRNKHMRKQKRRNTDDGALNRHydrophilic
NLS Segment(s)
PositionSequence
77-90RRPRNKHMRKQKRR
Subcellular Location(s) mito 17, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MIPKLSGLQRGSALLRSLKFLGISISALHLTASVIKVVSPPPHLLICDSEESEGLSSPIATRIYVHPFSNSAFLPVRRPRNKHMRKQKRRNTDDGALNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.23
5 0.21
6 0.2
7 0.17
8 0.16
9 0.13
10 0.13
11 0.1
12 0.1
13 0.09
14 0.09
15 0.09
16 0.07
17 0.06
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.09
25 0.11
26 0.12
27 0.12
28 0.14
29 0.15
30 0.15
31 0.15
32 0.14
33 0.14
34 0.13
35 0.13
36 0.11
37 0.1
38 0.1
39 0.1
40 0.08
41 0.06
42 0.04
43 0.04
44 0.04
45 0.07
46 0.07
47 0.07
48 0.08
49 0.11
50 0.17
51 0.2
52 0.2
53 0.19
54 0.2
55 0.21
56 0.22
57 0.19
58 0.17
59 0.18
60 0.18
61 0.26
62 0.32
63 0.42
64 0.47
65 0.53
66 0.58
67 0.66
68 0.76
69 0.79
70 0.82
71 0.83
72 0.87
73 0.93
74 0.94
75 0.94
76 0.91
77 0.89
78 0.86
79 0.83