Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Y616

Protein Details
Accession A0A165Y616    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-98LSTVQDEWKKRRWHKKRLFSGLEPSDHydrophilic
NLS Segment(s)
PositionSequence
81-89KKRRWHKKR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
Amino Acid Sequences MWQSASNSQESASRGEASVARVREGCTTKGDATWGQRQKHWEPGWDPETGVDRDKNQQERGIIGGAALLPVDLSTVQDEWKKRRWHKKRLFSGLEPSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.21
5 0.25
6 0.22
7 0.21
8 0.21
9 0.22
10 0.27
11 0.28
12 0.26
13 0.23
14 0.26
15 0.25
16 0.24
17 0.26
18 0.22
19 0.24
20 0.31
21 0.35
22 0.33
23 0.35
24 0.41
25 0.41
26 0.48
27 0.44
28 0.4
29 0.35
30 0.4
31 0.4
32 0.34
33 0.31
34 0.23
35 0.25
36 0.2
37 0.2
38 0.14
39 0.14
40 0.19
41 0.25
42 0.28
43 0.26
44 0.27
45 0.26
46 0.26
47 0.26
48 0.21
49 0.16
50 0.11
51 0.1
52 0.07
53 0.07
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.05
62 0.06
63 0.08
64 0.13
65 0.18
66 0.23
67 0.32
68 0.41
69 0.5
70 0.61
71 0.7
72 0.77
73 0.83
74 0.89
75 0.91
76 0.92
77 0.9
78 0.84