Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166DB85

Protein Details
Accession A0A166DB85    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-53LKARSGAPPPKQPKNKFPNNDFYSHydrophilic
NLS Segment(s)
PositionSequence
214-247RKAVTTKANGAKPTPKAKAKPKAEAKGKGKGKGR
Subcellular Location(s) nucl 13.5, cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027093  EAF_fam  
IPR019194  Tscrpt_elong_fac_Eaf_N  
Gene Ontology GO:0032783  C:super elongation complex  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF09816  EAF  
Amino Acid Sequences MLSSMSPNEWLPSAGGRHPVDLGPSLVRALKARSGAPPPKQPKNKFPNNDFYSFRYTFKPDSVDESKQGSIEAKSSSKEAGTSFRLERPSTQSDESHAFSGTVQPAKDWECVLIYDEENGTFTLEKLDSSVTWNYEGRVPPSKSTKPTPPSVTPPKIDIDLDAELSAAFGLEDAEGEIDPELEQKPRYEEEEEEEEIPLSAVAASQPIPAPPARKAVTTKANGAKPTPKAKAKPKAEAKGKGKGKGRTTQASAAAASSSRSTPLAAKREPPPLALPSSAPPKPSDILLPPSSAPSRTFQSIYEGSSDGSVAHSDSDDDMIPVSTVFPAEEEEEEAVEVDDEAFALELDEHLRDEDDADSNAPPTMHYQNGNRTGPVPLNQYAGNGEEDDYSSSEESDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.28
4 0.29
5 0.3
6 0.29
7 0.27
8 0.26
9 0.25
10 0.18
11 0.18
12 0.18
13 0.18
14 0.19
15 0.19
16 0.2
17 0.22
18 0.24
19 0.25
20 0.29
21 0.37
22 0.44
23 0.49
24 0.57
25 0.61
26 0.68
27 0.77
28 0.78
29 0.79
30 0.82
31 0.85
32 0.84
33 0.83
34 0.84
35 0.79
36 0.77
37 0.7
38 0.64
39 0.62
40 0.54
41 0.49
42 0.42
43 0.41
44 0.38
45 0.38
46 0.38
47 0.3
48 0.36
49 0.4
50 0.4
51 0.38
52 0.39
53 0.36
54 0.32
55 0.32
56 0.26
57 0.21
58 0.19
59 0.2
60 0.18
61 0.18
62 0.2
63 0.2
64 0.18
65 0.18
66 0.17
67 0.19
68 0.21
69 0.25
70 0.26
71 0.29
72 0.33
73 0.32
74 0.34
75 0.36
76 0.38
77 0.37
78 0.38
79 0.34
80 0.34
81 0.36
82 0.34
83 0.28
84 0.23
85 0.19
86 0.16
87 0.2
88 0.2
89 0.19
90 0.17
91 0.16
92 0.19
93 0.21
94 0.22
95 0.18
96 0.15
97 0.13
98 0.13
99 0.15
100 0.15
101 0.12
102 0.12
103 0.12
104 0.11
105 0.11
106 0.11
107 0.1
108 0.08
109 0.07
110 0.09
111 0.09
112 0.09
113 0.09
114 0.1
115 0.09
116 0.13
117 0.15
118 0.13
119 0.15
120 0.16
121 0.16
122 0.19
123 0.21
124 0.21
125 0.27
126 0.28
127 0.3
128 0.37
129 0.42
130 0.42
131 0.46
132 0.51
133 0.47
134 0.52
135 0.54
136 0.5
137 0.54
138 0.59
139 0.58
140 0.5
141 0.48
142 0.43
143 0.38
144 0.34
145 0.26
146 0.2
147 0.15
148 0.14
149 0.12
150 0.1
151 0.09
152 0.09
153 0.08
154 0.04
155 0.03
156 0.02
157 0.03
158 0.02
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.03
165 0.03
166 0.03
167 0.05
168 0.06
169 0.07
170 0.08
171 0.08
172 0.11
173 0.12
174 0.15
175 0.15
176 0.15
177 0.18
178 0.22
179 0.23
180 0.2
181 0.19
182 0.17
183 0.14
184 0.14
185 0.09
186 0.05
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.05
194 0.05
195 0.07
196 0.08
197 0.1
198 0.11
199 0.17
200 0.17
201 0.19
202 0.22
203 0.26
204 0.33
205 0.33
206 0.38
207 0.38
208 0.4
209 0.38
210 0.38
211 0.38
212 0.36
213 0.4
214 0.41
215 0.4
216 0.45
217 0.53
218 0.61
219 0.61
220 0.65
221 0.67
222 0.7
223 0.72
224 0.75
225 0.7
226 0.69
227 0.68
228 0.65
229 0.63
230 0.61
231 0.58
232 0.56
233 0.57
234 0.52
235 0.51
236 0.48
237 0.44
238 0.38
239 0.33
240 0.26
241 0.21
242 0.16
243 0.13
244 0.1
245 0.08
246 0.08
247 0.08
248 0.09
249 0.13
250 0.2
251 0.26
252 0.27
253 0.31
254 0.35
255 0.43
256 0.42
257 0.4
258 0.36
259 0.32
260 0.33
261 0.29
262 0.26
263 0.22
264 0.28
265 0.27
266 0.25
267 0.23
268 0.24
269 0.24
270 0.23
271 0.23
272 0.2
273 0.25
274 0.25
275 0.26
276 0.23
277 0.26
278 0.26
279 0.24
280 0.22
281 0.19
282 0.21
283 0.23
284 0.23
285 0.2
286 0.26
287 0.26
288 0.25
289 0.25
290 0.21
291 0.19
292 0.18
293 0.17
294 0.11
295 0.1
296 0.09
297 0.07
298 0.06
299 0.06
300 0.07
301 0.07
302 0.09
303 0.08
304 0.08
305 0.08
306 0.08
307 0.08
308 0.07
309 0.07
310 0.06
311 0.06
312 0.06
313 0.06
314 0.07
315 0.09
316 0.09
317 0.1
318 0.11
319 0.1
320 0.11
321 0.1
322 0.09
323 0.07
324 0.07
325 0.05
326 0.05
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.04
333 0.04
334 0.06
335 0.07
336 0.07
337 0.08
338 0.08
339 0.08
340 0.09
341 0.11
342 0.12
343 0.12
344 0.13
345 0.14
346 0.14
347 0.15
348 0.14
349 0.12
350 0.15
351 0.19
352 0.21
353 0.25
354 0.31
355 0.39
356 0.48
357 0.49
358 0.46
359 0.43
360 0.43
361 0.42
362 0.41
363 0.37
364 0.3
365 0.31
366 0.3
367 0.3
368 0.27
369 0.25
370 0.22
371 0.17
372 0.16
373 0.14
374 0.15
375 0.16
376 0.15
377 0.16
378 0.14
379 0.14