Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166DCJ9

Protein Details
Accession A0A166DCJ9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
275-300TDAFQCGRCKQRKTRYRQAQTRSADEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035100  TF_IIS-typ  
IPR003617  TFIIS/CRSP70_N_sub  
IPR035441  TFIIS/LEDGF_dom_sf  
IPR003618  TFIIS_cen_dom  
IPR036575  TFIIS_cen_dom_sf  
IPR017923  TFIIS_N  
IPR006289  TFSII  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003746  F:translation elongation factor activity  
GO:0008270  F:zinc ion binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF08711  Med26  
PF01096  TFIIS_C  
PF07500  TFIIS_M  
PROSITE View protein in PROSITE  
PS51321  TFIIS_CENTRAL  
PS51319  TFIIS_N  
PS00466  ZF_TFIIS_1  
PS51133  ZF_TFIIS_2  
CDD cd00183  TFIIS_I  
cd13749  Zn-ribbon_TFIIS  
Amino Acid Sequences MSDIAGDLKAKIKDLQAATSEPEITDILRNLKKNAVVTEKLLRDTKAGLAVGKLRQHSSKAVADLAKELVKKWKTEVEKEKASSGASSPAANGTKSSSTTPKAESARPTISTNSSSVATPASGGAKTPTTPGGPKSPDTKPRSAAADGVVFNHIGDRTRDKCCELVYDALASDSGAPVEQILSRARAIERKIFESHSGNVSAPYRTKMRSLYSNLKDKGNPGLRWSVVSGDTTVDKLCTMTSAEMASEERKRADEKIKQDNLFNSLAAGEAEAETDAFQCGRCKQRKTRYRQAQTRSADEPMTTFVTCVNCGNRWKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.3
4 0.31
5 0.32
6 0.32
7 0.3
8 0.22
9 0.22
10 0.18
11 0.16
12 0.17
13 0.17
14 0.23
15 0.27
16 0.3
17 0.3
18 0.34
19 0.37
20 0.37
21 0.4
22 0.39
23 0.37
24 0.39
25 0.45
26 0.43
27 0.44
28 0.43
29 0.38
30 0.32
31 0.31
32 0.29
33 0.25
34 0.23
35 0.19
36 0.19
37 0.23
38 0.26
39 0.29
40 0.29
41 0.27
42 0.29
43 0.31
44 0.32
45 0.33
46 0.33
47 0.3
48 0.32
49 0.31
50 0.29
51 0.28
52 0.27
53 0.24
54 0.2
55 0.2
56 0.25
57 0.26
58 0.26
59 0.27
60 0.33
61 0.35
62 0.45
63 0.53
64 0.52
65 0.57
66 0.58
67 0.56
68 0.5
69 0.45
70 0.36
71 0.27
72 0.24
73 0.17
74 0.16
75 0.14
76 0.17
77 0.18
78 0.17
79 0.16
80 0.15
81 0.15
82 0.17
83 0.19
84 0.19
85 0.21
86 0.24
87 0.25
88 0.29
89 0.3
90 0.33
91 0.34
92 0.35
93 0.35
94 0.35
95 0.35
96 0.31
97 0.3
98 0.28
99 0.25
100 0.21
101 0.18
102 0.16
103 0.14
104 0.12
105 0.1
106 0.08
107 0.08
108 0.08
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.1
115 0.1
116 0.1
117 0.12
118 0.14
119 0.19
120 0.21
121 0.23
122 0.27
123 0.31
124 0.39
125 0.44
126 0.45
127 0.41
128 0.41
129 0.43
130 0.38
131 0.33
132 0.25
133 0.23
134 0.2
135 0.18
136 0.16
137 0.12
138 0.11
139 0.11
140 0.09
141 0.07
142 0.08
143 0.12
144 0.15
145 0.19
146 0.2
147 0.2
148 0.22
149 0.21
150 0.22
151 0.19
152 0.17
153 0.14
154 0.14
155 0.12
156 0.11
157 0.1
158 0.08
159 0.06
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.04
167 0.06
168 0.06
169 0.08
170 0.08
171 0.1
172 0.11
173 0.14
174 0.16
175 0.21
176 0.22
177 0.24
178 0.26
179 0.27
180 0.29
181 0.28
182 0.28
183 0.24
184 0.23
185 0.19
186 0.2
187 0.19
188 0.18
189 0.16
190 0.17
191 0.17
192 0.17
193 0.2
194 0.21
195 0.24
196 0.29
197 0.35
198 0.42
199 0.46
200 0.54
201 0.54
202 0.53
203 0.5
204 0.45
205 0.47
206 0.45
207 0.39
208 0.33
209 0.37
210 0.34
211 0.34
212 0.33
213 0.26
214 0.19
215 0.19
216 0.16
217 0.12
218 0.12
219 0.12
220 0.11
221 0.09
222 0.08
223 0.08
224 0.07
225 0.07
226 0.08
227 0.08
228 0.09
229 0.09
230 0.09
231 0.1
232 0.11
233 0.14
234 0.16
235 0.17
236 0.17
237 0.19
238 0.21
239 0.26
240 0.34
241 0.37
242 0.42
243 0.52
244 0.59
245 0.58
246 0.6
247 0.57
248 0.53
249 0.46
250 0.38
251 0.27
252 0.19
253 0.18
254 0.13
255 0.11
256 0.07
257 0.05
258 0.06
259 0.06
260 0.06
261 0.05
262 0.06
263 0.06
264 0.06
265 0.07
266 0.1
267 0.17
268 0.27
269 0.35
270 0.44
271 0.53
272 0.64
273 0.73
274 0.8
275 0.85
276 0.86
277 0.89
278 0.9
279 0.88
280 0.87
281 0.83
282 0.79
283 0.71
284 0.63
285 0.53
286 0.44
287 0.37
288 0.3
289 0.28
290 0.22
291 0.18
292 0.18
293 0.19
294 0.2
295 0.23
296 0.24
297 0.26
298 0.34