Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4U2R3

Protein Details
Accession J4U2R3   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
36-61LEWFCRTSNHKKFKSHSLWKAVKNPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033394  Svf1-like_C  
IPR013931  Svf1-like_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006979  P:response to oxidative stress  
Pfam View protein in Pfam  
PF08622  Svf1  
PF17187  Svf1_C  
Amino Acid Sequences MAIAIKKEKTKFAPVREVLSEEDHDNYTKFQDTSKLEWFCRTSNHKKFKSHSLWKAVKNPTETRIETQTLYFTDLTNDKCGFIQLLYSSVMGGIYKGFQLNFKIFKASSKDESEENIDIWESFKIENIKDFDTLKVESDNVSFHFVPLENPSSNGFAQLLIKIDIPKGSTSSLLKDLKVDVTVNLQEGFIINPDGSNYYLDNSISLDELSKRDPSSTSRRMVRHVFVPRGFCNGTISYKKKDKLVKLDLNDTPMLYLDAVQGLIPNKAASKWNFLCFNGRKRSMMCIEFTTTKEYGSTTVTIWAVSDKEKILEVGSSVNDHAVKFPSTQEDKQNGWKYPTSIAFPRGFEESNLRLVNRYDIMGEVPAFIRSIAENLANMKPFIYQFCQRSKFEDDEGVSIIESTFIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.61
4 0.58
5 0.5
6 0.46
7 0.4
8 0.3
9 0.3
10 0.26
11 0.24
12 0.22
13 0.21
14 0.2
15 0.21
16 0.2
17 0.19
18 0.26
19 0.3
20 0.35
21 0.43
22 0.45
23 0.43
24 0.49
25 0.5
26 0.44
27 0.48
28 0.51
29 0.53
30 0.58
31 0.67
32 0.69
33 0.74
34 0.77
35 0.79
36 0.81
37 0.8
38 0.79
39 0.79
40 0.8
41 0.78
42 0.83
43 0.8
44 0.74
45 0.71
46 0.66
47 0.6
48 0.59
49 0.55
50 0.49
51 0.47
52 0.44
53 0.38
54 0.35
55 0.33
56 0.27
57 0.27
58 0.23
59 0.18
60 0.19
61 0.22
62 0.23
63 0.25
64 0.24
65 0.21
66 0.21
67 0.22
68 0.19
69 0.15
70 0.15
71 0.1
72 0.12
73 0.12
74 0.12
75 0.11
76 0.1
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.06
83 0.08
84 0.08
85 0.1
86 0.13
87 0.18
88 0.21
89 0.21
90 0.24
91 0.23
92 0.27
93 0.32
94 0.33
95 0.34
96 0.35
97 0.36
98 0.33
99 0.36
100 0.35
101 0.29
102 0.25
103 0.2
104 0.16
105 0.14
106 0.14
107 0.12
108 0.08
109 0.07
110 0.1
111 0.13
112 0.13
113 0.18
114 0.19
115 0.21
116 0.22
117 0.23
118 0.21
119 0.21
120 0.21
121 0.17
122 0.15
123 0.14
124 0.13
125 0.13
126 0.13
127 0.11
128 0.15
129 0.14
130 0.13
131 0.14
132 0.13
133 0.14
134 0.16
135 0.19
136 0.15
137 0.16
138 0.17
139 0.18
140 0.18
141 0.17
142 0.14
143 0.1
144 0.11
145 0.11
146 0.11
147 0.09
148 0.1
149 0.1
150 0.11
151 0.11
152 0.11
153 0.11
154 0.11
155 0.1
156 0.12
157 0.12
158 0.14
159 0.2
160 0.2
161 0.2
162 0.2
163 0.2
164 0.19
165 0.19
166 0.17
167 0.1
168 0.11
169 0.12
170 0.11
171 0.11
172 0.1
173 0.09
174 0.08
175 0.08
176 0.06
177 0.05
178 0.04
179 0.04
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.08
187 0.08
188 0.08
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.06
195 0.08
196 0.09
197 0.1
198 0.1
199 0.11
200 0.12
201 0.16
202 0.25
203 0.3
204 0.34
205 0.39
206 0.4
207 0.44
208 0.47
209 0.43
210 0.42
211 0.42
212 0.42
213 0.38
214 0.4
215 0.36
216 0.37
217 0.36
218 0.28
219 0.25
220 0.21
221 0.23
222 0.26
223 0.29
224 0.3
225 0.36
226 0.38
227 0.41
228 0.46
229 0.48
230 0.51
231 0.57
232 0.58
233 0.55
234 0.6
235 0.55
236 0.51
237 0.45
238 0.35
239 0.25
240 0.18
241 0.16
242 0.09
243 0.08
244 0.05
245 0.05
246 0.06
247 0.05
248 0.07
249 0.07
250 0.08
251 0.07
252 0.07
253 0.07
254 0.09
255 0.14
256 0.14
257 0.22
258 0.25
259 0.29
260 0.31
261 0.32
262 0.4
263 0.41
264 0.48
265 0.48
266 0.48
267 0.46
268 0.45
269 0.5
270 0.47
271 0.43
272 0.37
273 0.31
274 0.33
275 0.33
276 0.33
277 0.31
278 0.25
279 0.23
280 0.21
281 0.18
282 0.16
283 0.16
284 0.16
285 0.11
286 0.14
287 0.14
288 0.13
289 0.13
290 0.13
291 0.12
292 0.12
293 0.14
294 0.11
295 0.12
296 0.12
297 0.12
298 0.12
299 0.11
300 0.1
301 0.1
302 0.11
303 0.11
304 0.11
305 0.13
306 0.13
307 0.13
308 0.14
309 0.14
310 0.15
311 0.15
312 0.17
313 0.23
314 0.28
315 0.32
316 0.38
317 0.41
318 0.43
319 0.52
320 0.57
321 0.52
322 0.51
323 0.51
324 0.44
325 0.45
326 0.45
327 0.41
328 0.38
329 0.4
330 0.39
331 0.37
332 0.37
333 0.35
334 0.32
335 0.28
336 0.3
337 0.27
338 0.3
339 0.31
340 0.29
341 0.27
342 0.28
343 0.31
344 0.25
345 0.23
346 0.17
347 0.16
348 0.17
349 0.17
350 0.16
351 0.13
352 0.12
353 0.12
354 0.12
355 0.11
356 0.11
357 0.09
358 0.1
359 0.11
360 0.11
361 0.12
362 0.16
363 0.2
364 0.2
365 0.2
366 0.19
367 0.19
368 0.2
369 0.23
370 0.26
371 0.29
372 0.34
373 0.44
374 0.5
375 0.49
376 0.54
377 0.55
378 0.53
379 0.49
380 0.51
381 0.43
382 0.39
383 0.39
384 0.34
385 0.28
386 0.23
387 0.2