Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166FYT1

Protein Details
Accession A0A166FYT1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-45GLENRKTRTRRTHHTNNPLTTTSSSRNRKWYQRKNPNRRAGGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MFGLENRKTRTRRTHHTNNPLTTTSSSRNRKWYQRKNPNRRAGGLKAALHNPNTTSHGRKNAKHELRAMVSLSTRDRRQIQSSIDRFCNRYQRQSSTRTHAEIQGDSLRPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.87
4 0.87
5 0.81
6 0.77
7 0.68
8 0.61
9 0.52
10 0.46
11 0.42
12 0.43
13 0.45
14 0.44
15 0.52
16 0.56
17 0.64
18 0.71
19 0.75
20 0.76
21 0.81
22 0.88
23 0.9
24 0.94
25 0.93
26 0.86
27 0.79
28 0.74
29 0.66
30 0.61
31 0.54
32 0.46
33 0.38
34 0.38
35 0.36
36 0.3
37 0.27
38 0.21
39 0.18
40 0.2
41 0.2
42 0.2
43 0.21
44 0.3
45 0.34
46 0.37
47 0.42
48 0.49
49 0.52
50 0.51
51 0.52
52 0.46
53 0.44
54 0.42
55 0.35
56 0.26
57 0.21
58 0.2
59 0.21
60 0.21
61 0.2
62 0.23
63 0.27
64 0.3
65 0.34
66 0.37
67 0.39
68 0.45
69 0.49
70 0.5
71 0.52
72 0.51
73 0.49
74 0.49
75 0.54
76 0.47
77 0.52
78 0.53
79 0.56
80 0.59
81 0.64
82 0.66
83 0.64
84 0.65
85 0.59
86 0.56
87 0.52
88 0.5
89 0.43
90 0.41
91 0.39