Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EIV8

Protein Details
Accession J6EIV8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-58PPSADPSKARKNRPRPSGNEHydrophilic
NLS Segment(s)
PositionSequence
44-99PSKARKNRPRPSGNEGAIRDKASGRRNNKSKDVTDSAATKKPNTRKATDRHSRTGK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
PF09598  Stm1_N  
Amino Acid Sequences MSNPFDLLGNDVEDADVVVLPPKEIVKSSTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKASGRRNNKSKDVTDSAATKKPNTRKATDRHSRTGKTDTKKKVNQGWGDDKKELSAEKEAQADAAAEIAEDVEDAEERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.05
5 0.08
6 0.08
7 0.08
8 0.09
9 0.1
10 0.1
11 0.11
12 0.14
13 0.14
14 0.17
15 0.24
16 0.32
17 0.35
18 0.36
19 0.38
20 0.43
21 0.46
22 0.5
23 0.5
24 0.45
25 0.45
26 0.47
27 0.5
28 0.43
29 0.39
30 0.36
31 0.38
32 0.44
33 0.47
34 0.53
35 0.58
36 0.68
37 0.75
38 0.8
39 0.81
40 0.76
41 0.77
42 0.76
43 0.69
44 0.65
45 0.58
46 0.52
47 0.45
48 0.4
49 0.33
50 0.25
51 0.28
52 0.29
53 0.34
54 0.35
55 0.43
56 0.5
57 0.54
58 0.59
59 0.58
60 0.52
61 0.51
62 0.49
63 0.41
64 0.36
65 0.35
66 0.32
67 0.31
68 0.3
69 0.26
70 0.29
71 0.34
72 0.41
73 0.43
74 0.44
75 0.47
76 0.54
77 0.62
78 0.65
79 0.64
80 0.64
81 0.67
82 0.65
83 0.61
84 0.63
85 0.61
86 0.6
87 0.63
88 0.63
89 0.66
90 0.69
91 0.72
92 0.72
93 0.72
94 0.69
95 0.68
96 0.7
97 0.68
98 0.68
99 0.62
100 0.54
101 0.46
102 0.42
103 0.35
104 0.28
105 0.26
106 0.23
107 0.24
108 0.26
109 0.25
110 0.23
111 0.23
112 0.2
113 0.13
114 0.11
115 0.08
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04