Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WZI7

Protein Details
Accession A0A165WZI7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPTEVKPRPVRRQDRQDRQKRPFMSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPTEVKPRPVRRQDRQDRQKRPFMSKSSPPIQSMSCRPGPPDRSKAASSSVGDESSIAFQFSRSSDSTQATPLCKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.92
4 0.92
5 0.92
6 0.89
7 0.87
8 0.81
9 0.78
10 0.75
11 0.71
12 0.67
13 0.64
14 0.64
15 0.61
16 0.59
17 0.51
18 0.46
19 0.4
20 0.37
21 0.33
22 0.31
23 0.28
24 0.26
25 0.26
26 0.31
27 0.35
28 0.37
29 0.39
30 0.37
31 0.38
32 0.39
33 0.38
34 0.36
35 0.34
36 0.28
37 0.26
38 0.24
39 0.2
40 0.19
41 0.18
42 0.15
43 0.13
44 0.12
45 0.09
46 0.08
47 0.08
48 0.1
49 0.11
50 0.14
51 0.14
52 0.17
53 0.21
54 0.24
55 0.25
56 0.28
57 0.32