Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WHI4

Protein Details
Accession A0A165WHI4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
332-353FLPRSHDLRKRARQRIGKAKAAHydrophilic
NLS Segment(s)
PositionSequence
340-355RKRARQRIGKAKAANR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.333, cyto 7, cyto_mito 5.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MNGSSLSSYFVTSYQPNGTAVVDYALVSHSLIADSTSFLVQQTIDWSDHAYLALSLTVPQNLLPSPTPARAPIPHSLSPAVAMRRNLDHTLPLNKELLDAISCTPSRAALSQALYGVTSASPPPLIIFTAAASRSTPTSSAFAAVFHGPGSLRNRAIQIPGRQNYQRACLFAIWLALKNAPISRALTIYYSARSVFNDLLINAGHDAERGWRGPNANVIKHIILCIRSKPVPVVLKYLPKVSKHPHLIGAAKLCLSPQHPPRLADLPPTGPVRLLYVPAVTNSTFPPKLSGDTPPVPLPAPASQSPIPTNCDSISPDRNELESESDDTTPSFLPRSHDLRKRARQRIGKAKAANRQALYDKVRGRKLWWKDIRQTCDPSRSRPLPSAVSLSATMEVMSSRINVPAVIPDSFDHHRFQSVEAAAASIPFPSLDPTRSLVFSPNFTVDEVADVKGRTYLAMQPWRLSQTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.22
5 0.22
6 0.19
7 0.18
8 0.15
9 0.12
10 0.1
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.09
28 0.09
29 0.12
30 0.14
31 0.14
32 0.14
33 0.16
34 0.16
35 0.17
36 0.16
37 0.13
38 0.1
39 0.1
40 0.1
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.14
50 0.14
51 0.18
52 0.21
53 0.23
54 0.24
55 0.25
56 0.29
57 0.3
58 0.33
59 0.35
60 0.38
61 0.39
62 0.4
63 0.39
64 0.35
65 0.33
66 0.33
67 0.3
68 0.28
69 0.26
70 0.26
71 0.29
72 0.33
73 0.32
74 0.29
75 0.29
76 0.3
77 0.36
78 0.36
79 0.34
80 0.32
81 0.29
82 0.29
83 0.24
84 0.21
85 0.14
86 0.12
87 0.11
88 0.15
89 0.15
90 0.15
91 0.14
92 0.14
93 0.15
94 0.14
95 0.16
96 0.15
97 0.17
98 0.17
99 0.18
100 0.17
101 0.16
102 0.15
103 0.13
104 0.08
105 0.08
106 0.07
107 0.07
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.07
114 0.08
115 0.07
116 0.11
117 0.11
118 0.11
119 0.11
120 0.11
121 0.12
122 0.12
123 0.12
124 0.11
125 0.12
126 0.12
127 0.13
128 0.13
129 0.12
130 0.13
131 0.13
132 0.11
133 0.09
134 0.09
135 0.08
136 0.12
137 0.16
138 0.18
139 0.19
140 0.2
141 0.22
142 0.22
143 0.27
144 0.29
145 0.32
146 0.38
147 0.39
148 0.43
149 0.42
150 0.45
151 0.42
152 0.42
153 0.37
154 0.28
155 0.28
156 0.23
157 0.22
158 0.19
159 0.19
160 0.14
161 0.13
162 0.13
163 0.12
164 0.12
165 0.12
166 0.12
167 0.1
168 0.1
169 0.11
170 0.11
171 0.11
172 0.11
173 0.11
174 0.12
175 0.12
176 0.11
177 0.11
178 0.11
179 0.11
180 0.11
181 0.13
182 0.11
183 0.12
184 0.12
185 0.11
186 0.11
187 0.1
188 0.1
189 0.08
190 0.08
191 0.06
192 0.05
193 0.05
194 0.06
195 0.08
196 0.08
197 0.09
198 0.11
199 0.12
200 0.13
201 0.2
202 0.23
203 0.22
204 0.23
205 0.24
206 0.22
207 0.21
208 0.21
209 0.15
210 0.13
211 0.14
212 0.14
213 0.16
214 0.16
215 0.16
216 0.16
217 0.2
218 0.22
219 0.22
220 0.26
221 0.25
222 0.29
223 0.3
224 0.35
225 0.32
226 0.29
227 0.33
228 0.32
229 0.37
230 0.36
231 0.37
232 0.35
233 0.35
234 0.35
235 0.32
236 0.3
237 0.23
238 0.18
239 0.17
240 0.13
241 0.12
242 0.12
243 0.16
244 0.19
245 0.27
246 0.29
247 0.3
248 0.34
249 0.36
250 0.35
251 0.33
252 0.3
253 0.23
254 0.24
255 0.24
256 0.21
257 0.17
258 0.17
259 0.15
260 0.14
261 0.13
262 0.1
263 0.1
264 0.11
265 0.11
266 0.13
267 0.1
268 0.1
269 0.11
270 0.15
271 0.15
272 0.14
273 0.17
274 0.16
275 0.18
276 0.19
277 0.21
278 0.22
279 0.24
280 0.26
281 0.24
282 0.24
283 0.22
284 0.21
285 0.2
286 0.16
287 0.18
288 0.17
289 0.21
290 0.21
291 0.23
292 0.25
293 0.24
294 0.26
295 0.23
296 0.24
297 0.19
298 0.2
299 0.2
300 0.23
301 0.27
302 0.26
303 0.28
304 0.27
305 0.27
306 0.26
307 0.24
308 0.23
309 0.18
310 0.18
311 0.17
312 0.16
313 0.16
314 0.15
315 0.15
316 0.12
317 0.12
318 0.11
319 0.11
320 0.14
321 0.2
322 0.27
323 0.34
324 0.41
325 0.49
326 0.58
327 0.67
328 0.74
329 0.77
330 0.79
331 0.79
332 0.82
333 0.84
334 0.81
335 0.8
336 0.76
337 0.74
338 0.73
339 0.71
340 0.67
341 0.57
342 0.53
343 0.48
344 0.47
345 0.45
346 0.44
347 0.43
348 0.44
349 0.49
350 0.46
351 0.48
352 0.5
353 0.54
354 0.58
355 0.61
356 0.62
357 0.67
358 0.75
359 0.77
360 0.74
361 0.74
362 0.69
363 0.7
364 0.65
365 0.61
366 0.62
367 0.59
368 0.57
369 0.54
370 0.54
371 0.47
372 0.47
373 0.46
374 0.36
375 0.34
376 0.3
377 0.26
378 0.22
379 0.18
380 0.15
381 0.1
382 0.09
383 0.07
384 0.07
385 0.08
386 0.08
387 0.09
388 0.1
389 0.09
390 0.1
391 0.15
392 0.17
393 0.16
394 0.16
395 0.15
396 0.21
397 0.24
398 0.26
399 0.24
400 0.22
401 0.26
402 0.26
403 0.27
404 0.29
405 0.26
406 0.26
407 0.23
408 0.23
409 0.19
410 0.18
411 0.17
412 0.09
413 0.08
414 0.06
415 0.07
416 0.1
417 0.13
418 0.14
419 0.17
420 0.2
421 0.22
422 0.23
423 0.24
424 0.28
425 0.27
426 0.29
427 0.3
428 0.3
429 0.28
430 0.28
431 0.28
432 0.2
433 0.22
434 0.2
435 0.18
436 0.17
437 0.16
438 0.16
439 0.17
440 0.17
441 0.14
442 0.15
443 0.2
444 0.26
445 0.35
446 0.37
447 0.37
448 0.42
449 0.47