Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165Z877

Protein Details
Accession A0A165Z877    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-86QFGANPHHKKKDVRKGRVQISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MPPFKAGKGGSAGSGAAGDGGAFNLTPEQIKALVGNNGVAPGAGPLIDLGEGGEVRGFGVAGDGGQFGANPHHKKKDVRKGRVQIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.06
4 0.05
5 0.04
6 0.03
7 0.04
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.07
19 0.09
20 0.1
21 0.1
22 0.11
23 0.09
24 0.09
25 0.09
26 0.07
27 0.06
28 0.04
29 0.04
30 0.03
31 0.03
32 0.02
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.11
56 0.19
57 0.24
58 0.3
59 0.38
60 0.43
61 0.53
62 0.63
63 0.68
64 0.72
65 0.76
66 0.81