Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YCL1

Protein Details
Accession A0A165YCL1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
431-456ISSAMTPDRNPPKKSNKSGSGHGRKSHydrophilic
NLS Segment(s)
PositionSequence
441-455PPKKSNKSGSGHGRK
Subcellular Location(s) cyto_nucl 11.333, cyto 10, nucl 9.5, cyto_mito 8.999, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences MIPAESLAFRIRADQPHWIVSPLDAHLFLHIHSASLCDFHPGRNIVRAAIRMASGELAKEQLVLAILKADQVEHLNLTHTLSAVNGQIGFMVEGPCTVSISATWTTYRAEVHQYFTISESEEAAQAIKPGSTDINDQPSDNASSRPDTADTSSIRATEAQSTTRVDSQLAVPEPSPANLSTTAPSDATPQNSLDLSQTIRPAETQKRRREGSTEPVDEQEEPSAAKRSRKALSAPQGVQEEDAHIVDAGPAVINPTIKDMPKPAVPSQPLPETTPQTKYAVATVPPTLPDVVRPVASVREIGYEGELEGIAYRIVRAGDPNVGPPRDGQWVKLSIRLSVSGVKFPPQKRVFKLHEEPLPVAKGVDKLTSLMLKGEEVKATVPRDLTAGEQDVKNVAIPANVPFVYQFVLQEISDEEIKKDVSKARKSKSDISSAMTPDRNPPKKSNKSGSGHGRKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.44
4 0.44
5 0.41
6 0.36
7 0.31
8 0.31
9 0.24
10 0.23
11 0.17
12 0.16
13 0.17
14 0.17
15 0.16
16 0.18
17 0.16
18 0.14
19 0.14
20 0.15
21 0.13
22 0.14
23 0.14
24 0.15
25 0.16
26 0.17
27 0.24
28 0.26
29 0.28
30 0.33
31 0.34
32 0.31
33 0.34
34 0.34
35 0.29
36 0.28
37 0.25
38 0.19
39 0.19
40 0.18
41 0.14
42 0.13
43 0.12
44 0.11
45 0.11
46 0.1
47 0.09
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.09
58 0.11
59 0.12
60 0.12
61 0.12
62 0.13
63 0.13
64 0.15
65 0.14
66 0.11
67 0.1
68 0.09
69 0.11
70 0.1
71 0.1
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.08
78 0.08
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.06
87 0.1
88 0.11
89 0.12
90 0.12
91 0.13
92 0.14
93 0.15
94 0.16
95 0.14
96 0.21
97 0.21
98 0.25
99 0.26
100 0.26
101 0.25
102 0.26
103 0.25
104 0.18
105 0.17
106 0.14
107 0.12
108 0.11
109 0.11
110 0.1
111 0.09
112 0.09
113 0.09
114 0.08
115 0.07
116 0.08
117 0.09
118 0.09
119 0.13
120 0.15
121 0.21
122 0.22
123 0.22
124 0.22
125 0.23
126 0.25
127 0.21
128 0.2
129 0.15
130 0.17
131 0.18
132 0.18
133 0.17
134 0.16
135 0.17
136 0.2
137 0.19
138 0.2
139 0.2
140 0.18
141 0.18
142 0.17
143 0.16
144 0.16
145 0.17
146 0.16
147 0.17
148 0.18
149 0.2
150 0.2
151 0.2
152 0.15
153 0.15
154 0.14
155 0.18
156 0.17
157 0.16
158 0.14
159 0.16
160 0.16
161 0.16
162 0.16
163 0.11
164 0.12
165 0.12
166 0.13
167 0.11
168 0.13
169 0.13
170 0.12
171 0.12
172 0.14
173 0.15
174 0.16
175 0.16
176 0.15
177 0.15
178 0.15
179 0.15
180 0.12
181 0.11
182 0.1
183 0.11
184 0.12
185 0.11
186 0.11
187 0.12
188 0.16
189 0.25
190 0.33
191 0.41
192 0.47
193 0.54
194 0.56
195 0.56
196 0.55
197 0.5
198 0.5
199 0.5
200 0.44
201 0.38
202 0.38
203 0.37
204 0.33
205 0.29
206 0.19
207 0.11
208 0.09
209 0.09
210 0.14
211 0.14
212 0.17
213 0.2
214 0.24
215 0.26
216 0.28
217 0.3
218 0.33
219 0.4
220 0.43
221 0.41
222 0.39
223 0.38
224 0.36
225 0.33
226 0.25
227 0.17
228 0.11
229 0.11
230 0.07
231 0.06
232 0.06
233 0.05
234 0.05
235 0.04
236 0.03
237 0.03
238 0.04
239 0.04
240 0.05
241 0.05
242 0.08
243 0.11
244 0.11
245 0.12
246 0.13
247 0.15
248 0.18
249 0.22
250 0.21
251 0.26
252 0.27
253 0.29
254 0.31
255 0.32
256 0.3
257 0.29
258 0.29
259 0.28
260 0.28
261 0.29
262 0.28
263 0.25
264 0.25
265 0.23
266 0.22
267 0.19
268 0.17
269 0.16
270 0.16
271 0.14
272 0.14
273 0.15
274 0.13
275 0.11
276 0.11
277 0.12
278 0.12
279 0.12
280 0.12
281 0.12
282 0.13
283 0.13
284 0.13
285 0.1
286 0.11
287 0.11
288 0.11
289 0.1
290 0.09
291 0.08
292 0.08
293 0.07
294 0.05
295 0.05
296 0.05
297 0.04
298 0.04
299 0.04
300 0.05
301 0.05
302 0.06
303 0.07
304 0.09
305 0.13
306 0.14
307 0.19
308 0.24
309 0.24
310 0.24
311 0.23
312 0.24
313 0.28
314 0.28
315 0.25
316 0.25
317 0.31
318 0.31
319 0.35
320 0.33
321 0.27
322 0.28
323 0.27
324 0.23
325 0.23
326 0.23
327 0.23
328 0.23
329 0.27
330 0.33
331 0.34
332 0.43
333 0.43
334 0.49
335 0.5
336 0.59
337 0.59
338 0.61
339 0.67
340 0.64
341 0.62
342 0.58
343 0.55
344 0.49
345 0.45
346 0.36
347 0.29
348 0.23
349 0.21
350 0.18
351 0.18
352 0.15
353 0.14
354 0.16
355 0.17
356 0.16
357 0.15
358 0.14
359 0.13
360 0.15
361 0.16
362 0.15
363 0.14
364 0.15
365 0.19
366 0.2
367 0.21
368 0.19
369 0.18
370 0.18
371 0.18
372 0.18
373 0.17
374 0.19
375 0.19
376 0.19
377 0.19
378 0.19
379 0.19
380 0.17
381 0.15
382 0.12
383 0.1
384 0.11
385 0.12
386 0.16
387 0.16
388 0.15
389 0.14
390 0.15
391 0.16
392 0.15
393 0.14
394 0.11
395 0.13
396 0.12
397 0.13
398 0.13
399 0.14
400 0.17
401 0.17
402 0.16
403 0.16
404 0.17
405 0.18
406 0.21
407 0.26
408 0.32
409 0.42
410 0.51
411 0.57
412 0.65
413 0.71
414 0.76
415 0.75
416 0.75
417 0.67
418 0.64
419 0.62
420 0.57
421 0.57
422 0.5
423 0.45
424 0.45
425 0.53
426 0.55
427 0.54
428 0.6
429 0.65
430 0.73
431 0.81
432 0.82
433 0.81
434 0.79
435 0.83
436 0.85
437 0.85