Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AGI0

Protein Details
Accession A0A166AGI0   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-52QSQQSRRQKALEEQKRKRERRVEGSRHHIDLHydrophilic
101-130AQSVGSTSTKRKKNRKKKKSNQYADRCMYAHydrophilic
NLS Segment(s)
PositionSequence
35-42QKRKRERR
110-119KRKKNRKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017336  Snurportin-1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0061015  P:snRNA import into nucleus  
Amino Acid Sequences MSTMHPPSRRESFKTPPISGEQSQQSRRQKALEEQKRKRERRVEGSRHHIDLFSKLSLGPDPLSEDEDGEVEIVREGVAGMASMLPPAVPEASMEVETTDAQSVGSTSTKRKKNRKKKKSNQYADRCMYAELLEMNGMDLQTMSDNGIPDDLQVNWIALAPVPRGKRCLALTHSSAGNPGTVPTTLHSRVRGSTFLTFPSPLPPDSILDCILDVCWHDNGILHILDVIRWHGQDIGDSEANFRFWWRDARLQEMKPVIPPAPSQPSDNKFTYPTNFLPIPYYIPLPFQDFLQRVIPLARASRVVNIRVPNIVPTPGDDGADMDLDLPRDRLDEMSCESDGLLLYDAQASYESGTTPLSLWVPAKPLDGEYESRLDILERILIAAQTPTAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.67
3 0.61
4 0.61
5 0.61
6 0.55
7 0.53
8 0.52
9 0.52
10 0.56
11 0.61
12 0.64
13 0.63
14 0.64
15 0.61
16 0.58
17 0.59
18 0.65
19 0.67
20 0.69
21 0.72
22 0.8
23 0.87
24 0.87
25 0.87
26 0.85
27 0.84
28 0.84
29 0.86
30 0.85
31 0.83
32 0.87
33 0.83
34 0.76
35 0.67
36 0.58
37 0.48
38 0.43
39 0.37
40 0.28
41 0.23
42 0.2
43 0.2
44 0.19
45 0.2
46 0.16
47 0.13
48 0.16
49 0.16
50 0.18
51 0.17
52 0.16
53 0.14
54 0.14
55 0.13
56 0.1
57 0.09
58 0.06
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.04
77 0.05
78 0.07
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.08
87 0.07
88 0.06
89 0.06
90 0.06
91 0.07
92 0.09
93 0.1
94 0.18
95 0.27
96 0.35
97 0.44
98 0.55
99 0.65
100 0.74
101 0.84
102 0.88
103 0.91
104 0.94
105 0.96
106 0.96
107 0.96
108 0.95
109 0.94
110 0.92
111 0.84
112 0.75
113 0.64
114 0.53
115 0.43
116 0.32
117 0.23
118 0.13
119 0.1
120 0.08
121 0.07
122 0.06
123 0.06
124 0.06
125 0.05
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.08
138 0.07
139 0.07
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.07
147 0.07
148 0.12
149 0.14
150 0.15
151 0.17
152 0.18
153 0.21
154 0.21
155 0.26
156 0.26
157 0.28
158 0.29
159 0.29
160 0.29
161 0.25
162 0.24
163 0.18
164 0.14
165 0.1
166 0.08
167 0.07
168 0.07
169 0.07
170 0.07
171 0.12
172 0.14
173 0.15
174 0.16
175 0.17
176 0.18
177 0.2
178 0.2
179 0.17
180 0.17
181 0.17
182 0.16
183 0.16
184 0.16
185 0.14
186 0.17
187 0.16
188 0.14
189 0.14
190 0.14
191 0.14
192 0.14
193 0.15
194 0.12
195 0.11
196 0.1
197 0.09
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.05
204 0.06
205 0.06
206 0.07
207 0.09
208 0.08
209 0.07
210 0.08
211 0.07
212 0.08
213 0.07
214 0.08
215 0.07
216 0.07
217 0.08
218 0.08
219 0.08
220 0.09
221 0.11
222 0.13
223 0.13
224 0.13
225 0.15
226 0.14
227 0.14
228 0.13
229 0.12
230 0.09
231 0.1
232 0.16
233 0.18
234 0.25
235 0.26
236 0.34
237 0.41
238 0.4
239 0.44
240 0.41
241 0.37
242 0.32
243 0.33
244 0.25
245 0.2
246 0.2
247 0.2
248 0.24
249 0.25
250 0.26
251 0.31
252 0.34
253 0.39
254 0.39
255 0.36
256 0.31
257 0.33
258 0.33
259 0.31
260 0.29
261 0.29
262 0.28
263 0.27
264 0.26
265 0.24
266 0.24
267 0.2
268 0.21
269 0.16
270 0.17
271 0.18
272 0.2
273 0.19
274 0.17
275 0.22
276 0.21
277 0.23
278 0.24
279 0.23
280 0.19
281 0.2
282 0.21
283 0.17
284 0.18
285 0.17
286 0.17
287 0.17
288 0.23
289 0.26
290 0.27
291 0.29
292 0.3
293 0.31
294 0.31
295 0.3
296 0.27
297 0.25
298 0.24
299 0.19
300 0.18
301 0.22
302 0.2
303 0.2
304 0.17
305 0.16
306 0.15
307 0.15
308 0.12
309 0.08
310 0.08
311 0.09
312 0.1
313 0.09
314 0.09
315 0.09
316 0.1
317 0.11
318 0.12
319 0.14
320 0.18
321 0.21
322 0.21
323 0.2
324 0.19
325 0.18
326 0.16
327 0.14
328 0.11
329 0.07
330 0.08
331 0.09
332 0.09
333 0.08
334 0.09
335 0.08
336 0.09
337 0.09
338 0.09
339 0.08
340 0.09
341 0.09
342 0.09
343 0.11
344 0.11
345 0.13
346 0.14
347 0.15
348 0.18
349 0.19
350 0.2
351 0.19
352 0.19
353 0.22
354 0.24
355 0.25
356 0.25
357 0.27
358 0.25
359 0.24
360 0.24
361 0.2
362 0.17
363 0.15
364 0.14
365 0.11
366 0.12
367 0.12
368 0.12
369 0.12
370 0.12