Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X639

Protein Details
Accession A0A165X639   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
222-242GFADRPMHRRPLPKRRAYGRPBasic
NLS Segment(s)
PositionSequence
229-242HRRPLPKRRAYGRP
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MLQQFYATQSAAARVQDAASRMQLLLEQSRESLLPGASYGEGSGGTYLQYSGNQEEVEQPHHFGDSNVNRGISNHNKGIVLEKGLDETVDGGVSGSDGRSADEDADRSGSVGSGDSGNDTDDAPAVLPGHNHMDNILTQWRRDARRANLYAYRVWTARSIEIAHRHLPLVLELGEDGMSSDSSDREGRRTVYRIHKPPTPRPRGVSDILYWLDEVAFHSQNGFADRPMHRRPLPKRRAYGRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.18
5 0.17
6 0.16
7 0.17
8 0.15
9 0.15
10 0.16
11 0.16
12 0.2
13 0.19
14 0.19
15 0.18
16 0.19
17 0.19
18 0.18
19 0.17
20 0.12
21 0.1
22 0.1
23 0.11
24 0.1
25 0.1
26 0.09
27 0.07
28 0.07
29 0.07
30 0.07
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.08
37 0.1
38 0.11
39 0.12
40 0.12
41 0.12
42 0.17
43 0.18
44 0.21
45 0.2
46 0.2
47 0.19
48 0.19
49 0.19
50 0.14
51 0.22
52 0.22
53 0.26
54 0.26
55 0.26
56 0.26
57 0.26
58 0.33
59 0.32
60 0.31
61 0.28
62 0.29
63 0.28
64 0.29
65 0.31
66 0.25
67 0.19
68 0.15
69 0.13
70 0.13
71 0.12
72 0.12
73 0.08
74 0.08
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.07
89 0.07
90 0.08
91 0.08
92 0.09
93 0.08
94 0.08
95 0.07
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.05
112 0.05
113 0.05
114 0.04
115 0.06
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.11
123 0.16
124 0.13
125 0.13
126 0.17
127 0.22
128 0.23
129 0.28
130 0.33
131 0.34
132 0.43
133 0.45
134 0.46
135 0.46
136 0.45
137 0.43
138 0.39
139 0.34
140 0.25
141 0.24
142 0.22
143 0.18
144 0.17
145 0.17
146 0.16
147 0.18
148 0.24
149 0.26
150 0.26
151 0.25
152 0.24
153 0.23
154 0.22
155 0.18
156 0.14
157 0.11
158 0.09
159 0.08
160 0.08
161 0.07
162 0.06
163 0.06
164 0.05
165 0.05
166 0.05
167 0.06
168 0.05
169 0.08
170 0.11
171 0.12
172 0.14
173 0.17
174 0.2
175 0.25
176 0.28
177 0.34
178 0.41
179 0.51
180 0.56
181 0.58
182 0.61
183 0.64
184 0.71
185 0.74
186 0.73
187 0.69
188 0.65
189 0.67
190 0.67
191 0.63
192 0.56
193 0.47
194 0.43
195 0.38
196 0.34
197 0.28
198 0.22
199 0.18
200 0.14
201 0.14
202 0.13
203 0.13
204 0.12
205 0.13
206 0.14
207 0.16
208 0.2
209 0.19
210 0.15
211 0.21
212 0.26
213 0.33
214 0.38
215 0.45
216 0.46
217 0.55
218 0.64
219 0.69
220 0.75
221 0.77
222 0.82