Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166I3A9

Protein Details
Accession A0A166I3A9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23QPQRSRNARAQARHREKRKAYIAHydrophilic
NLS Segment(s)
PositionSequence
14-17HREK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences QPQRSRNARAQARHREKRKAYIAQLEETVKKLQDAMSLTREDLASLPAPQSRIRDLEEENEKLRSELDYVKQQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.8
4 0.8
5 0.79
6 0.76
7 0.7
8 0.69
9 0.64
10 0.56
11 0.54
12 0.47
13 0.39
14 0.33
15 0.28
16 0.19
17 0.16
18 0.14
19 0.12
20 0.12
21 0.14
22 0.14
23 0.16
24 0.16
25 0.16
26 0.16
27 0.16
28 0.13
29 0.11
30 0.1
31 0.08
32 0.08
33 0.09
34 0.09
35 0.11
36 0.13
37 0.15
38 0.16
39 0.18
40 0.19
41 0.22
42 0.22
43 0.28
44 0.33
45 0.34
46 0.33
47 0.32
48 0.31
49 0.27
50 0.26
51 0.2
52 0.17
53 0.2
54 0.24
55 0.31