Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X6H3

Protein Details
Accession A0A165X6H3   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
66-91DDNAGGKKKKGNKRRKVNHACLYCRRBasic
NLS Segment(s)
PositionSequence
71-81GKKKKGNKRRK
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MMDASPAGGSWATSSSHHAQDHSHAQSQAFGPSQNNSNQSASSQVQRTFSNDGGQVSSGGGGGDDDDNAGGKKKKGNKRRKVNHACLYCRRSHMTCDEGRPCQRCIKREIGHLCHDEPKQAHPHQRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.25
4 0.26
5 0.26
6 0.26
7 0.3
8 0.38
9 0.36
10 0.36
11 0.31
12 0.31
13 0.33
14 0.32
15 0.3
16 0.22
17 0.19
18 0.16
19 0.17
20 0.21
21 0.21
22 0.23
23 0.23
24 0.23
25 0.22
26 0.21
27 0.24
28 0.22
29 0.22
30 0.24
31 0.22
32 0.24
33 0.24
34 0.27
35 0.25
36 0.24
37 0.22
38 0.2
39 0.18
40 0.17
41 0.16
42 0.13
43 0.1
44 0.09
45 0.07
46 0.05
47 0.04
48 0.03
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.06
57 0.07
58 0.09
59 0.14
60 0.23
61 0.33
62 0.43
63 0.54
64 0.62
65 0.72
66 0.81
67 0.88
68 0.89
69 0.9
70 0.88
71 0.85
72 0.82
73 0.8
74 0.74
75 0.66
76 0.6
77 0.55
78 0.47
79 0.44
80 0.41
81 0.39
82 0.38
83 0.43
84 0.44
85 0.46
86 0.51
87 0.5
88 0.48
89 0.51
90 0.53
91 0.5
92 0.5
93 0.54
94 0.52
95 0.58
96 0.65
97 0.61
98 0.63
99 0.63
100 0.59
101 0.56
102 0.52
103 0.49
104 0.41
105 0.42
106 0.43
107 0.46
108 0.54