Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZX22

Protein Details
Accession A0A165ZX22   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
219-248PETGEPPAKRPRGRPKGSKNKPKVLPLPTSHydrophilic
NLS Segment(s)
PositionSequence
225-241PAKRPRGRPKGSKNKPK
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MQSVVQQQQQQQQQTQQSTQPHSLVNVSNIPVQEPYPKPIVAQGHDWTKNLIQLAKTAELKKHALTLQLHTAHILAAHASLDQKNKALQDIKEQKNRIESERKRLLDDLAQINSDRDKIDLSESSITKETADLRSKIQSLTDGPYAVAKRDVDVLRQELGQPPLPSLQSTLEERNAAYLTSRRLRGQMPPISVSTSIEVSRNMSNTSGSTSMPETQRNPETGEPPAKRPRGRPKGSKNKPKVLPLPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.53
4 0.53
5 0.54
6 0.54
7 0.48
8 0.41
9 0.37
10 0.37
11 0.33
12 0.3
13 0.28
14 0.25
15 0.25
16 0.24
17 0.24
18 0.21
19 0.2
20 0.24
21 0.23
22 0.25
23 0.26
24 0.26
25 0.25
26 0.29
27 0.34
28 0.28
29 0.31
30 0.32
31 0.37
32 0.39
33 0.4
34 0.37
35 0.32
36 0.32
37 0.29
38 0.27
39 0.18
40 0.19
41 0.23
42 0.25
43 0.28
44 0.28
45 0.29
46 0.3
47 0.32
48 0.29
49 0.3
50 0.26
51 0.28
52 0.27
53 0.29
54 0.32
55 0.32
56 0.31
57 0.27
58 0.26
59 0.2
60 0.18
61 0.14
62 0.07
63 0.05
64 0.05
65 0.05
66 0.07
67 0.09
68 0.11
69 0.12
70 0.13
71 0.15
72 0.15
73 0.19
74 0.22
75 0.2
76 0.29
77 0.38
78 0.44
79 0.5
80 0.51
81 0.48
82 0.51
83 0.52
84 0.47
85 0.48
86 0.44
87 0.47
88 0.54
89 0.53
90 0.48
91 0.47
92 0.43
93 0.35
94 0.36
95 0.29
96 0.21
97 0.21
98 0.19
99 0.19
100 0.17
101 0.15
102 0.11
103 0.07
104 0.07
105 0.07
106 0.09
107 0.09
108 0.11
109 0.14
110 0.13
111 0.15
112 0.15
113 0.15
114 0.13
115 0.13
116 0.13
117 0.15
118 0.18
119 0.17
120 0.18
121 0.21
122 0.22
123 0.21
124 0.19
125 0.15
126 0.14
127 0.16
128 0.15
129 0.13
130 0.12
131 0.16
132 0.16
133 0.14
134 0.15
135 0.12
136 0.11
137 0.17
138 0.17
139 0.16
140 0.18
141 0.2
142 0.18
143 0.18
144 0.19
145 0.16
146 0.19
147 0.2
148 0.18
149 0.17
150 0.19
151 0.19
152 0.18
153 0.16
154 0.15
155 0.14
156 0.17
157 0.19
158 0.19
159 0.19
160 0.18
161 0.19
162 0.17
163 0.14
164 0.13
165 0.13
166 0.17
167 0.22
168 0.25
169 0.24
170 0.26
171 0.28
172 0.34
173 0.4
174 0.4
175 0.39
176 0.39
177 0.38
178 0.38
179 0.36
180 0.31
181 0.23
182 0.19
183 0.16
184 0.15
185 0.15
186 0.15
187 0.17
188 0.17
189 0.17
190 0.15
191 0.16
192 0.15
193 0.18
194 0.17
195 0.15
196 0.15
197 0.17
198 0.21
199 0.24
200 0.28
201 0.27
202 0.32
203 0.36
204 0.36
205 0.38
206 0.36
207 0.36
208 0.38
209 0.45
210 0.41
211 0.46
212 0.54
213 0.58
214 0.59
215 0.66
216 0.7
217 0.72
218 0.78
219 0.81
220 0.83
221 0.86
222 0.92
223 0.94
224 0.92
225 0.91
226 0.89
227 0.88
228 0.85