Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166HGY1

Protein Details
Accession A0A166HGY1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
6-26PVPNLIKKSRGRRVPTRTVSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAPPVPVPNLIKKSRGRRVPTRTVSDSEETRPTSRNYVCEVKQCGKRFSRGEHLKRHIRSIHTNEKPFKCPFHSCDKYFSRFDNLTQHQKVHKSPAFNTDVTEKIAMNSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.68
4 0.71
5 0.77
6 0.81
7 0.8
8 0.78
9 0.72
10 0.67
11 0.63
12 0.57
13 0.5
14 0.43
15 0.4
16 0.35
17 0.32
18 0.32
19 0.29
20 0.32
21 0.31
22 0.3
23 0.3
24 0.34
25 0.35
26 0.38
27 0.42
28 0.42
29 0.48
30 0.49
31 0.49
32 0.45
33 0.5
34 0.47
35 0.45
36 0.49
37 0.52
38 0.54
39 0.57
40 0.62
41 0.63
42 0.61
43 0.62
44 0.55
45 0.49
46 0.5
47 0.49
48 0.52
49 0.51
50 0.56
51 0.58
52 0.58
53 0.59
54 0.53
55 0.49
56 0.44
57 0.42
58 0.4
59 0.44
60 0.47
61 0.44
62 0.5
63 0.52
64 0.52
65 0.49
66 0.48
67 0.44
68 0.38
69 0.39
70 0.4
71 0.41
72 0.46
73 0.46
74 0.47
75 0.46
76 0.5
77 0.5
78 0.51
79 0.48
80 0.44
81 0.44
82 0.49
83 0.49
84 0.44
85 0.43
86 0.37
87 0.36
88 0.33
89 0.32
90 0.23