Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EKD3

Protein Details
Accession J6EKD3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
127-151APVAKLKKKTKTYADKKANKNKDGSHydrophilic
NLS Segment(s)
PositionSequence
131-150KLKKKTKTYADKKANKNKDG
156-163ERMKKLRR
Subcellular Location(s) extr 16, E.R. 4, golg 3, mito 2
Family & Domain DBs
CDD cd22209  EMC10  
Amino Acid Sequences MRLLRIFSLASVVLGADILQLSYSDDKKDIIPLGSFEIDSGSDGNITVTTVDVQNVQVSGQHCLNAEIKGKLDMPCFSYMKLETPLRYDLIVDVDDNNEVSQVSLSYNEKNDAIVGMARYPEAGPSAPVAKLKKKTKTYADKKANKNKDGSTAQFERMKKLRRSLGFKRTGKCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.07
9 0.11
10 0.12
11 0.13
12 0.14
13 0.15
14 0.16
15 0.2
16 0.2
17 0.18
18 0.17
19 0.17
20 0.2
21 0.2
22 0.19
23 0.15
24 0.13
25 0.12
26 0.11
27 0.1
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.09
45 0.1
46 0.12
47 0.12
48 0.12
49 0.12
50 0.14
51 0.16
52 0.15
53 0.17
54 0.15
55 0.15
56 0.15
57 0.17
58 0.17
59 0.17
60 0.16
61 0.16
62 0.19
63 0.19
64 0.18
65 0.18
66 0.16
67 0.17
68 0.2
69 0.19
70 0.15
71 0.18
72 0.19
73 0.17
74 0.17
75 0.15
76 0.11
77 0.11
78 0.1
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.06
92 0.08
93 0.1
94 0.11
95 0.12
96 0.12
97 0.12
98 0.11
99 0.09
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.07
108 0.07
109 0.08
110 0.07
111 0.07
112 0.09
113 0.11
114 0.11
115 0.16
116 0.19
117 0.25
118 0.34
119 0.42
120 0.5
121 0.55
122 0.62
123 0.68
124 0.75
125 0.78
126 0.8
127 0.83
128 0.83
129 0.86
130 0.89
131 0.89
132 0.82
133 0.78
134 0.7
135 0.68
136 0.65
137 0.58
138 0.56
139 0.5
140 0.51
141 0.52
142 0.5
143 0.49
144 0.5
145 0.55
146 0.54
147 0.59
148 0.63
149 0.65
150 0.73
151 0.75
152 0.78
153 0.79
154 0.79