Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J6EJ28

Protein Details
Accession J6EJ28    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-58EKSNLEKKPFRKNTLRKSIMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005678  Tim17  
Gene Ontology GO:0005744  C:TIM23 mitochondrial import inner membrane translocase complex  
GO:0008320  F:protein transmembrane transporter activity  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF02466  Tim17  
Amino Acid Sequences MALFKPAGSPGPLSRLSFLCQISKVKSPIFIKRPGTVEKSNLEKKPFRKNTLRKSIMSADHSRDPCPIVILNDFGGAFAMGAIGGVVWHGVKGFRNSPLGERRSGAVSAIKARAPVLGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGALAVRGGWRHTRNSSITCACLLGVIEGVGLMFQRYSAWQAKPMAPPLPEAPPSQPLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.31
5 0.31
6 0.28
7 0.29
8 0.32
9 0.33
10 0.38
11 0.38
12 0.34
13 0.4
14 0.41
15 0.48
16 0.49
17 0.54
18 0.51
19 0.52
20 0.56
21 0.54
22 0.55
23 0.49
24 0.48
25 0.45
26 0.49
27 0.52
28 0.52
29 0.53
30 0.53
31 0.55
32 0.62
33 0.65
34 0.65
35 0.68
36 0.73
37 0.78
38 0.82
39 0.82
40 0.72
41 0.69
42 0.68
43 0.62
44 0.58
45 0.52
46 0.45
47 0.47
48 0.47
49 0.42
50 0.36
51 0.32
52 0.26
53 0.23
54 0.2
55 0.14
56 0.14
57 0.15
58 0.13
59 0.13
60 0.12
61 0.1
62 0.09
63 0.07
64 0.05
65 0.04
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.04
78 0.05
79 0.08
80 0.1
81 0.13
82 0.15
83 0.16
84 0.21
85 0.28
86 0.28
87 0.27
88 0.26
89 0.24
90 0.24
91 0.23
92 0.19
93 0.13
94 0.12
95 0.13
96 0.14
97 0.13
98 0.12
99 0.12
100 0.12
101 0.1
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.08
109 0.07
110 0.06
111 0.05
112 0.03
113 0.04
114 0.04
115 0.04
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.09
122 0.14
123 0.2
124 0.24
125 0.29
126 0.33
127 0.36
128 0.45
129 0.52
130 0.49
131 0.47
132 0.43
133 0.39
134 0.35
135 0.31
136 0.22
137 0.14
138 0.11
139 0.08
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.03
146 0.04
147 0.05
148 0.05
149 0.08
150 0.14
151 0.17
152 0.22
153 0.25
154 0.3
155 0.34
156 0.37
157 0.42
158 0.38
159 0.36
160 0.32
161 0.3
162 0.24
163 0.2
164 0.17
165 0.1
166 0.08
167 0.07
168 0.06
169 0.05
170 0.05
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.04
177 0.06
178 0.11
179 0.17
180 0.19
181 0.25
182 0.29
183 0.35
184 0.4
185 0.43
186 0.43
187 0.38
188 0.4
189 0.38
190 0.4
191 0.37
192 0.35
193 0.34
194 0.34