Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AVN6

Protein Details
Accession A0A166AVN6   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45GSWLRKIYRGDRSRRSRAKIKSEKVYHydrophilic
NLS Segment(s)
PositionSequence
30-40DRSRRSRAKIK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, cyto 6, cyto_mito 5.499, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MKHLENRDIPEIWSVASAPGSWLRKIYRGDRSRRSRAKIKSEKVYYRLEGDRSLPNELMAITLLYCVRSFDEQFVGEPSEWRHLMHVCSRWSSLIRSDSRFWRRINISWHSQTISRHLSLSKDSLLDLDITVHDQSVSDLKKLLRSTIGRAGALSIRTSYTHSQYYHERDSRSWSLLPMILDSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.12
4 0.11
5 0.1
6 0.17
7 0.19
8 0.19
9 0.23
10 0.24
11 0.29
12 0.35
13 0.4
14 0.44
15 0.5
16 0.59
17 0.65
18 0.72
19 0.77
20 0.8
21 0.81
22 0.79
23 0.79
24 0.82
25 0.82
26 0.8
27 0.79
28 0.8
29 0.78
30 0.74
31 0.71
32 0.61
33 0.56
34 0.51
35 0.43
36 0.36
37 0.33
38 0.33
39 0.3
40 0.31
41 0.25
42 0.22
43 0.2
44 0.18
45 0.15
46 0.1
47 0.08
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.09
56 0.1
57 0.1
58 0.12
59 0.12
60 0.13
61 0.13
62 0.14
63 0.12
64 0.12
65 0.12
66 0.14
67 0.14
68 0.13
69 0.13
70 0.13
71 0.15
72 0.19
73 0.22
74 0.2
75 0.21
76 0.21
77 0.21
78 0.21
79 0.2
80 0.19
81 0.21
82 0.22
83 0.24
84 0.26
85 0.34
86 0.39
87 0.42
88 0.39
89 0.39
90 0.4
91 0.41
92 0.45
93 0.41
94 0.42
95 0.4
96 0.41
97 0.35
98 0.34
99 0.31
100 0.3
101 0.29
102 0.23
103 0.21
104 0.2
105 0.21
106 0.2
107 0.22
108 0.17
109 0.14
110 0.13
111 0.13
112 0.12
113 0.11
114 0.09
115 0.08
116 0.07
117 0.08
118 0.08
119 0.07
120 0.07
121 0.06
122 0.07
123 0.12
124 0.13
125 0.12
126 0.15
127 0.16
128 0.22
129 0.22
130 0.23
131 0.25
132 0.26
133 0.3
134 0.35
135 0.38
136 0.32
137 0.32
138 0.32
139 0.28
140 0.27
141 0.22
142 0.15
143 0.13
144 0.14
145 0.18
146 0.2
147 0.22
148 0.26
149 0.26
150 0.29
151 0.36
152 0.43
153 0.49
154 0.5
155 0.48
156 0.44
157 0.52
158 0.52
159 0.48
160 0.42
161 0.34
162 0.33
163 0.33
164 0.32
165 0.25