Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166HY26

Protein Details
Accession A0A166HY26    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRVLGHKRGKRNSRPNTSLIHydrophilic
NLS Segment(s)
PositionSequence
16-20KRGKR
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRGKRNSRPNTSLIQIEGVSSKEDAQFYLGKRVAYVYRAKKEIEGSKVRVIWGRVTRPHGNSGVVKSKFRSNLPPHCFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.35
17 0.25
18 0.2
19 0.18
20 0.14
21 0.12
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.13
29 0.14
30 0.2
31 0.21
32 0.19
33 0.19
34 0.21
35 0.19
36 0.19
37 0.26
38 0.25
39 0.27
40 0.29
41 0.29
42 0.29
43 0.33
44 0.35
45 0.34
46 0.33
47 0.32
48 0.34
49 0.35
50 0.34
51 0.32
52 0.28
53 0.28
54 0.29
55 0.3
56 0.31
57 0.37
58 0.41
59 0.41
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.36
67 0.35
68 0.34
69 0.38
70 0.39
71 0.4
72 0.45
73 0.44
74 0.52
75 0.57
76 0.61
77 0.56
78 0.54
79 0.52
80 0.42
81 0.4
82 0.32
83 0.27
84 0.22
85 0.21
86 0.2